Loading...
HomeMy WebLinkAbout2018 12-10 CCP Regular Session                                        !"      !              #  ! "#$    % & #  '  (#                   !"   #$%# %%             !"#$%&                      ! "   #      $    $          $                      %              &  '           ! "                       &          ' (!") * +,-./// - (  )              *      $    (  $        % , & 0+- -! # ( -++/ -+ (                  (                  )                     +  *  %                        !"    # $  %  &  ' "  *  ,   '        - % .   '    (    "    /   *  *    "    .     0 $        '   ) )    *  +       , $      +    /     . /   $1    1   . / "  '         "    $ -   -     ! *  /    "  /  +  *      $1  "  +  "  '       " "   "     .   $-  *       *  /   *    !2 *  3 $   *  & "   4 2 567,. 2  /   3+   '        ". $     / "   + 0  1234   1 !  #.     /   *      .    0 $    %             !  0    '      . 5  %    )  , $   '          % 6'%7 8  ,  "  /   *  3 $  *  & "    4 2 56#8 $*./  . (  .$+   '        ". $     / "   + 0  1295" +$)  !    :   .$     4 /   . .  9- '       "   (1 ) 0//10!/1,!-/1/ 2 03!4-/  /   / + *. :+   '       " :$   '       " '       8  " )    % " ;     < ) / "   0      <  "     0  =     :>!   /   *  &  +  .     %   / 0    :   4 ; *         %  .  7<; *   "   *  &  8=      0  /  ;    . /   / /   0 ; 1  *   ! *   / (  '       " :$   '       " '       / "     ' =  "! ,  " ;  + + 0 <  "  " "   '    3<  "     / ">          <   "   "   .   < "  "       .  1 /   *  :/ - '     + = " :$   '     + = " '    !  (#;!* "< ( .;!* "<(    .; !* "<( 4"!* "< (!   "! "  * !  *   >#    !   / 8  . . + :  ?       !  '       " :$   '       "  '         !  "   8     / "     &9   8   "  "                 ?          8 %       /             1  ,) ,  @  6A 3  '       " :$   '       " 5 0-/// 6 !/+/  *  /  A 3 +  =  ,) ,    . .,) ,   '     . @  # "  >  "4A  4      4A 4    * !  *   >  0 $    /  *    '      "  8   )   " &      ".  " @  3( * !  *       !   / (      '      "  8   )   "     ".    " . .   @ 3(  !, ' +7                 !"   #  $% &   '( %)  ""*'+ !                        !"    # $  %  &  ' "   ! "',&''& '5$)7 0,187(62)7+(352&((',1*62)7+(&,7<&281&,/ 2)7+(&,7<2)%522./<1&(17(5,17+(&2817< 2)+(11(3,1$1'7+(67$7(2)0,11(627$  678'<6(66,21 129(0%(5 &,7<+$//±&281&,/&+$0%(56  &$//7225'(5  7KH%URRNO\Q&HQWHU&LW\&RXQFLOPHWLQ6WXG\6HVVLRQFDOOHGWRRUGHUE\0D\RU7LP:LOOVRQ DWSP  52//&$//  0D\RU 7LP :LOOVRQ DQG &RXQFLOPHPEHUV 0DUTXLWD %XWOHU $SULO *UDYHV DQG 'DQ 5\DQ &RXQFLOPHPEHU .ULV /DZUHQFH$QGHUVRQ ZDV DEVHQW DQG H[FXVHG  $OVR SUHVHQW ZHUH &LW\ 0DQDJHU &XUW %RJDQH\ 'HSXW\ &LW\ 0DQDJHU 5HJJLH (GZDUGV &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU0HJ%HHNPDQ3ODQQHUDQG=RQLQJ$GPLQLVWUDWRU*LQQ\0F,QWRVK&LW\$WWRUQH\7UR\ *LOFKULVWDQG0DU\0XOOHQ7LPH6DYHU2II6LWH6HFUHWDULDO,QF  &,7<&281&,/',6&866,212)$*(1'$,7(06$1'48(67,216  0U%RJDQH\UHTXHVWHGWKHIROORZLQJFRUUHFWLRQVWRWKH5HJXODU0HHWLQJPLQXWHVRI1RYHPEHU  3DJHSDUDJUDSKOLQHUHSODFH³.LP´ZLWK³.KH0HH´ 3DJHSDUDJUDSKOLQHUHSODFH³3DQ\D³ZLWK³<RXQJ&KD´  &RXQFLOPHPEHU %XWOHU UHTXHVWHG WKH IROORZLQJ FRUUHFWLRQ WR WKH:RUN 6HVVLRQ PLQXWHV RI 1RYHPEHU 3DJHSDUDJUDSKOLQHUHSODFH³*UDYHV´ZLWK³%XWOHU´  ,WZDVWKHPDMRULW\FRQVHQVXVRIWKH&LW\&RXQFLOWRDFFHSWWKHFRUUHFWLRQVWRWKH1RYHPEHU 5HJXODU0HHWLQJPLQXWHVDQG1RYHPEHU:RUN6HVVLRQPLQXWHV  0U%RJDQH\VWDWHGDQLWHPRQWRQLJKW¶V:RUN6HVVLRQ$JHQGDUHODWHGWRDGHYHORSPHQWSURMHFW ZRXOGEHDGGUHVVHGGXULQJWKH:RUN6HVVLRQDIWHUWKH5HJXODU0HHWLQJ  0D\RU :LOOVRQ DVNHG UHJDUGLQJ 5HJXODU 0HHWLQJ $JHQGD ,WHP DZKHWKHU WKH <RXWK $UW $ZDUGSDUWLFLSDQWVZLOOUHFHLYHDQDZDUGDQGKDYHWKHLUSKRWRWDNHQ0U%RJDQH\FRQILUPHG WKLV+HDGGHGWKHDUWZRUNKDVEHHQGLVSOD\HGRQWKH&RXQFLO&KDPEHUVZDOO0D\RU:LOOVRQ VWDWHGWKH\ORRNH[FHOOHQW '5$)7 0,6&(//$1(286  0U%RJDQH\VWDWHGWKH&LW\6WDIIKDGUHFHLYHGDGGLWLRQDOLQIRUPDWLRQUHJDUGLQJ%URRNO\Q3DUN¶V $JH)ULHQGO\&RPPXQLW\,QLWLDWLYH+HQRWHG&LW\6WDIILVIXOO\VXSSRUWLYHRIWKHLQLWLDWLYHDQG UHODWHG/LVWHQLQJ'LVFXVVLRQ6HVVLRQVKDYHEHHQLQFOXGHGWRWKH:LQWHU6SULQJFDWDORJXH7ZR VHVVLRQVDUHVFKHGXOHGIRU$SULOIURPDPDQGSP  &RXQFLOPHPEHU 5\DQ H[SUHVVHG KLVVXSSRUW RI WKHVH OLVWHQLQJ VHVVLRQV DQG DVNHG ZKHWKHU QRWLILFDWLRQFRXOGEHDGGHGWRWKH&LW\¶V)DFHERRNSDJH0U%RJDQH\VWDWHGWKHVHVVLRQVZLOOEH SXEOLVKHG LQ WKH QH[W &LW\ QHZVOHWWHU DQG GHWDLOV ZLOO EH LQFOXGHG LQ WKH XSFRPLQJ :HHNO\ XSGDWH  0D\RU:LOOVRQDVNHGZKHWKHUWKHVHVHVVLRQVDUHRSHQWRDOODJHJURXSV&RXQFLOPHPEHU5\DQ VWDWHGWKHVLPLODUFRPPXQLW\LQLWLDWLYHVDUHDYDLODEOHIRUUHVLGHQWVZKRDUH\HDUVRUROGHU  0U%RJDQH\VWDWHGWKHQRWLILFDWLRQVGRQRWVSHFLI\DQDJHOLPLWDQGWKHLQIRUPDWLRQVHVVLRQV ZLOOEHRSHQWRDOOUHVLGHQWVZKRKDYHDQLQWHUHVWLQWKHWRSLFUHJDUGOHVVRIWKHLUDJH  &RXQFLOPHPEHU*UDYHVVWDWHGVKHSODQVWRDWWHQGD³7KLQN$JDLQ%URRNO\QV´RQ1RYHPEHU DWSPDW%URRNO\Q3DUN&LW\+DOO6KHDGGHGWKHWRSLFIRUWKHHYHQLQJLV³NHHSLQJ ROGHUDGXOWVZLWKGLVDELOLWLHVZLWKIDPLO\´  0U%RJDQH\UHYLHZHGWKH&LW\&RXQFLO¶VGLVFXVVLRQDWWKHLU5HJXODU0HHWLQJRQ1RYHPEHU DWZKLFKWKH7WREDFFRLQLWLDWLYHZDVGLVFXVVHG+HVWDWHG&RXQFLOPHPEHU*UDYHV FRPPHQWHGRQWKHQHFHVVLW\RISUHYHQWLQJWKHFULPLQDOL]DWLRQRI\RXWKZKRXVHWREDFFR+H DGGHGDFRPPHQWZDVPDGHWKDWWKDWVHFWLRQRIWKH2UGLQDQFHZDVUHPRYHGRUGHOHWHG  0U%RJDQH\VWDWHGWKH3ROLFH&KLHI*DQQRQUHTXHVWHGFODULILFDWLRQUHJDUGLQJWKHLQWHQWRIWKLV VWDWHPHQWUHJDUGLQJ\RXWKFULPLQDOL]DWLRQ+HDGGHG3ROLFH&KLHI*DQQRQVSHFLILHGWKDWXQGHU 6WDWH6WDWXWHDSHUVRQXQGHUWKHDJHRISRVVHVVLQJDWREDFFRSURGXFWFDQEHSURVHFXWHGIRUD SHWW\PLVGHPHDQRU+HQRWHGLQWKHSDVWWKLVKDVUDUHO\RFFXUUHGLQ%URRNO\Q&HQWHUDV\RXWK DUHJHQHUDOO\UHTXLUHGWRSDUWLFLSDWHLQWKH'LYHUVLRQ3URJUDPLQVWHDG  &RXQFLOPHPEHU *UDYHV VWDWHG PDQ\ JURXSV HQFRXUDJHG WKH &LW\ &RXQFLO WR SDVV WKH 7 RUGLQDQFHDQGH[SUHVVHGFRQFHUQWKDWWKHRUGLQDQFHZRXOGQRWUHVXOWLQDQLQFUHDVHLQFLWDWLRQV IRUXQGHUDJHWREDFFRXVHLIWKDWZDVWKHLURQO\LQIUDFWLRQ  0U%RJDQH\VWDWHGWKH&LW\2UGLQDQFHUHODWHVWRFLWDWLRQVIRUSHRSOHWKDWDUHRYHU\HDUVRI DJH7KHUHLVQR&LW\SHQDOW\IRUSHRSOHZKRDUH\HDUVRIDJH  &RXQFLOPHPEHU*UDYHVVWDWHGWKHUHLVVWLOOVRPHGLVFUHWLRQRQWKHSDUWRIWKH3ROLFH2IILFHU6KH UHTXHVWHG VSHFLILF GDWD UHJDUGLQJ \RXWK ZKR KDYH SDUWLFLSDWHG LQ WKH 'LYHUVLRQ 3URJUDP '5$)7 LQFOXGLQJZKHWKHUWKH\ILQLVKHGWKHSURJUDPDVZHOODVSDUWLFLSDQWGHPRJUDSKLFV0U%RJDQH\ FRQILUPHGWKDW&LW\6WDIIFDQJDWKHUGDWDDQGSURYLGHWKDWLQIRUPDWLRQ  &RXQFLOPHPEHU5\DQDQG&RXQFLOPHPEHU %XWOHU H[SUHVVHG WKHLU VXSSRUW RI &RXQFLOPHPEHU *UDYH¶VUHTXHVW  ,WZDVWKHPDMRULW\FRQVHQVXVRIWKH&LW\&RXQFLOWRLQVWUXFW&LW\6WDIIWRSURYLGHDGGLWLRQDO LQIRUPDWLRQUHJDUGLQJ\RXWKSDUWLFLSDQWVRIWKH'LYHUVLRQ3URJUDPIRUUHYLHZDQGFRQVLGHUDWLRQ  $'-28510(17  0D\RU:LOOVRQFORVHGWKH6WXG\6HVVLRQDWSP    '5$)7 0,187(62)7+(352&((',1*62)7+(&,7<&281&,/ 2)7+(&,7<2)%522./<1&(17(5,17+(&2817< 2)+(11(3,1$1'7+(67$7(2)0,11(627$  5(*8/$56(66,21 129(0%(5 &,7<+$//±&281&,/&+$0%(56   ,1)250$/23(1)2580:,7+&,7<&281&,/  &$//7225'(5,1)250$/23(1)2580  7KH%URRNO\Q&HQWHU&LW\&RXQFLOPHWLQ,QIRUPDO2SHQ)RUXPFDOOHGWRRUGHUE\0D\RU7LP :LOOVRQDWSP  52//&$//  0D\RU 7LP :LOOVRQ DQG &RXQFLOPHPEHUV 0DUTXLWD %XWOHU $SULO *UDYHV DQG 'DQ 5\DQ &RXQFLOPHPEHU .ULV /DZUHQFH$QGHUVRQ ZDV DEVHQW DQG H[FXVHG  $OVR SUHVHQW ZHUH &LW\ 0DQDJHU &XUW %RJDQH\ 'HSXW\ &LW\ 0DQDJHU 5HJJLH (GZDUGV &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU0HJ%HHNPDQ3ODQQLQJDQG=RQLQJ$GPLQLVWUDWRU*LQQ\0F,QWRVKDQG0DU\0XOOHQ 7LPH6DYHU2II6LWH6HFUHWDULDO,QF  0D\RU7LP:LOOVRQRSHQHGWKHPHHWLQJIRUWKHSXUSRVHRI,QIRUPDO2SHQ)RUXP  7LP+DUDOGVRQQG$YHQXH1DVNHGZKHWKHUWKH&LW\KDVDQ\LQIRUPDWLRQDERXWWKH FORVXUHRIWKH:HOOV)DUJRGULYHWKURXJKEDQNRQ%URRNO\Q%RXOHYDUG  0D\RU:LOOVRQVWDWHGWKHQ&LW\KDVQRWEHHQQRWLILHG0U%RJDQH\FRQILUPHGWKLVDGGLQJQRW DOOORFDOEXVLQHVVHVDUHUHTXLUHGE\ODZWRQRWLI\WKH&LW\RIWKHLUFORVXUH  0RWLRQE\&RXQFLOPHPEHU5\DQVHFRQGHGE\&RXQFLOPHPEHU*UDYHVWRFORVHWKH,QIRUPDO 2SHQ)RUXPDWSP  0RWLRQSDVVHGXQDQLPRXVO\   ,192&$7,21  &RXQFLOPHPEHU%XWOHUUHDGWKHIROORZLQJTXRWHVDVDQ,QYRFDWLRQ  ³7KDQNIXOQHVV LV WKH EHJLQQLQJ RI JUDWLWXGH  *UDWLWXGH LV WKHFRPSOHWLRQ RI WKDQNIXOQHVV 7KDQNIXOQHVVPD\FRQVLVWRIPHUHO\ZRUGV*UDWLWXGHLVVKRZQLQDFWV´+HQUL)UpGpULF$PLHO    '5$)7 ³:HOHDUQHGDERXWJUDWLWXGHDQGKXPLOLW\±WKDWVRPDQ\SHRSOHKDGDKDQGLQRXUVXFFHVVIURP WKHWHDFKHUVZKRLQVSLUHGXVWRWKHMDQLWRUVZKRNHSWRXUVFKRROFOHDQ$QGZHZHUHWDXJKWWR YDOXHHYHU\RQH¶VFRQWULEXWLRQDQGWUHDWHYHU\RQHZLWKUHVSHFW´0LFKHOOH2EDPD   &$//7225'(55(*8/$5%86,1(660((7,1*  7KH%URRNO\Q&HQWHU&LW\&RXQFLOPHWLQ5HJXODU6HVVLRQFDOOHGWRRUGHUE\0D\RU7LP:LOOVRQ DWSP   52//&$//  0D\RU 7LP :LOOVRQ DQG &RXQFLOPHPEHUV 0DUTXLWD %XWOHU $SULO *UDYHV DQG 'DQ 5\DQ &RXQFLOPHPEHU .ULV /DZUHQFH$QGHUVRQ ZDV DEVHQW DQG H[FXVHG  $OVR SUHVHQW ZHUH &LW\ 0DQDJHU &XUW %RJDQH\ 'HSXW\ &LW\ 0DQDJHU 5HJJLH (GZDUGV &RPPXQLW\ 'HYHORSPHQW 'LUHFWRU0HJ%HHNPDQ3ODQQLQJDQG=RQLQJ$GPLQLVWUDWRU*LQQ\0F,QWRVKDQG0DU\0XOOHQ 7LPH6DYHU2II6LWH6HFUHWDULDO,QF   3/('*(2)$//(*,$1&(  7KH3OHGJHRI$OOHJLDQFHZDVUHFLWHG   $33529$/2)$*(1'$$1'&216(17$*(1'$  &RXQFLOPHPEHU5\DQPRYHGDQG&RXQFLOPHPEHU%XWOHUVHFRQGHGWRDSSURYHWKH$JHQGDDQG &RQVHQW$JHQGDDVDPHQGHGZLWKDPHQGPHQWVWRWKH5HJXODU&RXQFLO0HHWLQJPLQXWHVRI 1RYHPEHUDQGWKHIROORZLQJFRQVHQWLWHPVZHUHDSSURYHG  D $33529$/2)0,187(6 1RYHPEHU±6SHFLDO&RXQFLO0HHWLQJ&DQYDVVLQJ%RDUG 1RYHPEHU6WXG\6HVVLRQ 1RYHPEHU±5HJXODU&RXQFLO0HHWLQJ 1RYHPEHU±:RUN6HVVLRQ0HHWLQJ  E /,&(16(6  ),5(:25./,&(16(6 $PHULFDQ3URPRWLRQDO(YHQWV '%$717)LUHZRUNV   &RXQW\5RDG1R &XE)RRGV $PHULFDQ3URPRWLRQDO(YHQWV '%$717)LUHZRUNV   6KLQJOH&UHHN3DUNZD\ 7DUJHW  *$62/,1(6(59,&(67$7,21/,&(16(6 5R\DOW\ 6RQV,QF    %URRNO\Q%RXOHYDUG %URRNO\Q%3% URRNO\Q&HQWHU   '5$)7  /,48252))6$/(0$/7 $ZDG&RPSDQ\    +XPEROGW$YHQXH1 : L Q Q H U  * D V  % URRNO\Q&HQWHU01 'LDPRQG/DNH//&   &RXQW\5RDG &XE)RRGV% URRNO\Q&HQWHU01 . X  / H Q J   %URRNO\Q%RXOHYDUG 6XQ)RRGV% URRNO\Q&HQWHU01 1RUWKHUQ7LHU5HWDLO//&   %URRNO\Q%RXOHYDUG 6SHHGZD\% URRNO\Q&HQWHU01 1RUWKHUQ7LHU5HWDLO//&   WK$YHQXH1 6SHHGZD\% URRNO\Q&HQWHU01 1RUWKHUQ7LHU5HWDLO//&   :HVW5LYHU5RDG   % URRNO\Q&HQWHU01  0(&+$1,&$/ $GYDQFH+HDWLQJDQG$&   .DQJDURR6WUHHW1( 5 D P V H \   0 1   7RQQD0HFKDQLFDO,QF  ,QGXVWULDO'ULYH1: 5 R F K H V W H U   0 1    6(&21'+$1'*22'6'($/(5 *DPHVWRS   6KLQJOH&UHHN3DUNZD\ % URRNO\Q&HQWHU01  6,*1&2175$&725 5RVH&LW\6LJQ,QF    &RXQW\5RDG ( D J O H  % H Q G   0 1    72%$&&2/,&(16(6 $ZDG&RPSDQLHV    +XPEROGW$YHQXH1 % URRNO\Q&HQWHU01 %OHX2FHDQ,QF    WK$YHQXH1 % URRNO\Q&HQWHU01 %URRNGDOH+ROLGD\   ;HU[HV$YHQXH1 % URRNO\Q&HQWHU01 &DVH\¶V*HQHUDO6WRUH   )UHHZD\%RXOHYDUG % URRNO\Q&HQWHU01 'LDPRQG/DNH//&   &RXQW\5RDG -HUU\¶V(QWHUSULVHV,QF   %URRNO\Q&HQWHU01 3UHPLHU7REDFFR   %URRNO\Q%RXOHYDUG % URRNO\Q&HQWHU 5R\DOW\ 6RQV,QF    %URRNO\Q%RXOHYDUG %URRNO\Q%3% URRNO\Q&HQWHU01 / H Q J  . X  %URRNO\Q%RXOHYDUG 6XQ)RRGV% URRNO\Q&HQWHU01   '5$)7 7ZR5LYHUV,QYHVWPHQW,QF   +XPEROGW$YHQXH1 % URRNO\Q&HQWHU01 :DOJUHHQV&RPSDQ\    %URRNO\Q%RXOHYDUG % URRNO\Q&HQWHU01  5(17$/ ,1,7,$/ 7<3(,,±WZR\HDUOLFHQVH  )UDQFH$YHQXH1  &HUEHUXV6)5+ROGLQJV 6FRWW$YHQXH1 0DLWODQG$FTXLVLWLRQ  5(1(:$/ 7<3(,,,±RQH\HDUOLFHQVH  *HRUJHWRZQ3DUN7RZQKRXVHV  :LHQVFK&RQVWUXFWLRQ PHWPLWLJDWLRQSODQ  WK$YHQXH1 -DPHV$YHQXH1  5R[DQQDQG3DWULFN.QLJKW  5(1(:$/ 7<3(,,±WZR\HDUOLFHQVH  UG$YHQXH1  $GHGDPROD2JXQGLSH -XG\/DQH  'DYLG6KHHWV PHWPLWLJDWLRQSODQ  /DNHVLGH$YHQXH  3DXO6ZHGEHUJ  5(1(:$/ 7<3(,±WKUHH\HDUOLFHQVH  WK$YHQXH1  1D/HH9DQJ PHWPLWLJDWLRQSODQ  VW&LUFOH  *KXODP3\DUDOL QG$YHQXH1  &RVFR3URSHUWLHV//& PHWPLWLJDWLRQSODQ  &ROID[$YHQXH1  'RQDOG6SHHVH -R\FH/DQH  -RKQ-RUJHQVHQ /LODF'ULYH1  &DUORV%DOLEUHUD 5HJHQW$YHQXH1  +RXD+HU PHWPLWLJDWLRQSODQ   0RWLRQSDVVHGXQDQLPRXVO\   35(6(17$7,216352&/$0$7,2165(&2*1,7,216'21$7,216  D <287+$57&217(67$:$5'6  &RPPXQLW\'HYHORSPHQW'LUHFWRU0HJ%HHNPDQVWDWHGWKH<RXWK$UW&RQWHVWZDVLQLWLDWHGDV DQHIIRUWWRVHHN\RXWKFRPPXQLW\HQJDJHPHQW3DUWLFLSDQWVZHUHDVNHGWRVXEPLWDZRUNRIDUW H[SUHVVLQJKRZWKH\ZDQWWRVHHWKHLUFRPPXQLW\LQLQFRQQHFWLRQZLWKWKH&LW\¶V &RPSUHKHQVLYH3ODQ6KHDGGHGSDUWLFLSDQWVPXVWEHVWXGHQWVLQJUDGHVZKRUHVLGHLQ %URRNO\Q&HQWHURUJRWRVFKRROLQ%URRNO\Q&HQWHU6KHQRWHGWKHHQWULHVZHUHMXGJHGE\WKH &LW\&RXQFLODQGSRLQWVZHUHJLYHQEDVHGRQLQWHUSUHWDWLRQDUWLVWLFPHULWDQGTXDOLW\RIWKH DUWZRUN  0V%HHNPDQVWDWHGWKH<RXWK$UW&RQWHVWZLQQHUVZLOOEHDQQRXQFHGWKLVHYHQLQJ6KHDGGHG WKH\ZLOOUHFHLYHD&HUWLILFDWHD7DUJHWJLIWFDUGDQGDSKRWRZLWK0D\RU:LOOVRQ6KHQRWHGWKH   '5$)7 DUWZRUNLVFXUUHQWO\EHLQJKXQJLQWKH&RXQFLO&KDPEHUVEXWDSHUPDQHQWKRPHZLOOEHIRXQGLQ RQHRIWKH&LW\¶VSXEOLFIDFLOLWLHV  0D\RU:LOOVRQUHTXHVWHGWKDWSKRWRJUDSKVRIWKHDUWZRUNEHVFDQQHGDQGSRVWHGRQWKH&LW\¶V ZHEVLWH0V%HHNPDQDJUHHG  0D\RU:LOOVRQSUHVHQWHGWKH<RXWK$UW&RQWHVWZLQQHUV )DGRXO%DNHU±6HFRQGDQG7KLUG3ODFHWKWKJUDGHFDWHJRU\±QRWSUHVHQW $QQD<DQJ±)LUVW3ODFHWKWKJUDGHFDWHJRU\ 0D\RU:LOOVRQUHDGIURP0V<DQJ¶VHQWU\³SHRSOHKROGLQJKDQGVDURXQGWKHZRUOG7RJHWKHU ZHDUHVWURQJDQGFDQEHPRUHVXSSRUWLYHZLWKHDFKRWKHUQRPDWWHUZKDWQDWLRQDOLW\\RXDUH 7KLVLVZKDW%URRNO\Q&HQWHUZLOOEHLQ´ 0D\RU:LOOVRQSUHVHQWHGWKH$UW$ZDUGWR0V<DQJ  &KD/HH<DQJ±7KLUG3ODFHWKWKJUDGHFDWHJRU\±QRWSUHVHQW .KH0HH<DQJ±6HFRQG3ODFHWKWKJUDGHFDWHJRU\ 0D\RU:LOOVRQUHDGIURP0V<DQJ¶VHQWU\³7KHLPDJH,GUHZVKRZVWKHIXWXUHRI%URRNO\Q &HQWHU,ZDQWWRNHHSWKHFXOWXUHRIWKHHDUWK(GXFDWLRQWDNHVDQLPSRUWDQWUROHLQDSHUVRQ¶V OLIH0XOWLSOHEXLOGLQJVVKRZWKHH[SDQVLRQRI%URRNO\Q&HQWHU´ <RQJ&KD<DQJ±)LUVW3ODFHWKWKJUDGHFDWHJRU\ 0D\RU:LOOVRQUHDGIURP0V<DQJ¶VHQWU\³,QWKLVSRVWHUWKHUHDUHKDQGVKROGLQJDEDOOZKLFK LV%URRNO\Q&HQWHU(DFKKDQGKHOSVWRKROGWKHFRPPXQLW\XSDVWKHOLJKWEHFRPHVEULJKWHU,Q WKHIXWXUHWKHFRPPXQLW\ZLOOEHFRPHPRUHVDIHVHFXUHDQGORYHG´  0D\RU:LOOVRQFRQJUDWXODWHGWKH$UW&RQWHVWZLQQHUVDQGWKDQNHGDOOWKHSDUWLFLSDQWV   38%/,&+($5,1*6  1RQH   3/$11,1*&200,66,21,7(06  D 5(62/87,21 12  $33529,1* 3/$11,1* &200,66,21 $33/,&$7,2112)25$63(&,$/86(3(50,7)25$1$'8/7 '$<&$5()$&,/,7< /2&$7('$7%522./<1%28/(9$5'   3ODQQLQJDQG=RQLQJ$GPLQLVWUDWRU*LQQ\0F,QWRVKUHYLHZHGDQDSSOLFDWLRQIRUD6SHFLDO8VH 3HUPLWIRUDQDGXOWGD\FDUHIDFLOLW\DW%URRNO\Q%RXOHYDUG6KHVWDWHGWKHH[LVWLQJVWRU\ VWUXFWXUHZDVFRQVWUXFWHGLQDQGWKHDSSOLFDQWSURSRVHVWRXVHRQO\WKHPDLQIORRURIWKH VTXDUHIRRWEXLOGLQJ6KHQRWHGWKHDSSOLFDQW0RKDPHG$OEHUWLVDOVRWKH2ZQHUDQG $GPLQLVWUDWRURI6HUHQLW\+RPH+HDOWK&DUH6\VWHPLQ6W3DXO0U$OEHUWZDVSUHVHQWDWWKH PHHWLQJWRDQVZHUWKH&LW\&RXQFLO¶VTXHVWLRQVDQGUHFHLYHFRPPHQWV    '5$)7 0V0F,QWRVKVWDWHGQRWLILFDWLRQRIWKHUHTXHVWZDVSODFHGLQWKHORFDOQHZVSDSHUDVZHOODV OHWWHUVVHQWWRDGMDFHQWSURSHUW\RZQHUV6KHDGGHGWKH&'LVWULFWGRHVQRWDFNQRZOHGJH³DGXOW GD\FDUH´DVDXVHKRZHYHU6WDWH6WDWXWHGHILQHV³DGXOWGD\FDUH´DVSURYLVLRQRI³VHUYLFHVWR IXQFWLRQDOO\LPSDLUHGDGXOWVIRUOHVVWKDQKRXUVDGD\LQDVHWWLQJRWKHUWKDQDSULYDWHKRPH´ 6KHQRWHGWKHSURSRVHGDGXOWGD\FDUHZRXOGSURYLGHLQGLYLGXDOL]HGDQGFRRUGLQDWHGVHUYLFHV IURP0RQGD\WKURXJK6DWXUGD\IURPDP±SPDQGDPD[LPXPRIIRXUWUDQVSRUW YDQVZRXOGEHVWRUHGRQVLWH  0V0F,QWRVKVWDWHGWKHSURSRVHGDGXOWGD\FDUHZRXOGUHTXLUHQXUVLQJVWDIIDQGDLGVWR DVVLVWWKURXJKRXWWKHGD\6KHDGGHGWKHUHDUHSDUNLQJVSDFHVDQGDGGLWLRQDOSURRIRI SDUNLQJVSDFHDOWKRXJKRQO\SDUNLQJVSDFHVZRXOGEHUHTXLUHG6KHQRWHGDILUHLQVSHFWLRQ ZDVFRPSOHWHGDQGLQFOXGHVUHTXLUHPHQWVIRUUHVWULSLQJRISDUNLQJVSDFHVDVZHOODVPDLQWHQDQFH DQGPRQLWRULQJRIWKHILUHVSULQNOHUV\VWHP7KHXVHRIFRPEXVWLEOHVDQGH[WHQVLRQFRUGVLQD VWRUDJHURRPPXVWDOVREHDGGUHVVHG  0V0F,QWRVKVWDWHGRQVLWHSDUNLQJPXVWPHHWVLWHSODQDSSURYDOVLQFOXGLQJVLWHGHYHORSPHQW DSSURYDOVIURP7KH3ODQQLQJ&RPPLVVLRQKHOGDSXEOLFKHDULQJDWWKHLU1RYHPEHU PHHWLQJDQGWKHUHZHUHQRSXEOLFFRPPHQWV7KH3ODQQLQJ&RPPLVVLRQXQDQLPRXVO\ UHFRPPHQGHGDSSURYDORIWKH6SHFLDO8VH3HUPLW  &RXQFLOPHPEHU 5\DQ PRYHG DQG &RXQFLOPHPEHU *UDYHV VHFRQGHG WR DGRSW 5(62/87,21 12DSSURYLQJ3ODQQLQJ&RPPLVVLRQ$SSOLFDWLRQ1RIRUD6SHFLDO8VH 3HUPLWIRUDQ$GXOW'D\FDUH)DFLOLW\ /RFDWHGDW%URRNO\Q%RXOHYDUG   0RWLRQSDVVHGXQDQLPRXVO\   &281&,/&216,'(5$7,21,7(06  1RQH   &281&,/5(3257  &RXQFLOPHPEHU5\DQUHSRUWHGRQKLVDWWHQGDQFHDWWKHIROORZLQJDQGSURYLGHGLQIRUPDWLRQRQ WKHIROORZLQJXSFRPLQJHYHQWV x1RYHPEHU±WRXURI$ODWXVDSDUWPHQWGHYHORSPHQWLQ&U\VWDO±&LW\ &RXQFLOPHPEHUVKDGDFKDQFHWRYLHZWKHSURSHUW\WRGHWHUPLQHZKHWKHUDVLPLODUPXOWL IDPLO\XQLWZRXOGEHDJRRGILWIRU%URRNO\Q&HQWHU+HDGGHGKHUHFRPPHQGVPRYLQJ IRUZDUGZLWKWKLVSURSRVHGSURMHFW x'HFHPEHU±ZLOODWWHQG7UXWKLQ7D[DWLRQPHHWLQJDQGSXEOLFKHDULQJ)LQDQFH 'LUHFWRU1DWKDQ5HLQKDUGWZLOOSUHVHQWWKH%XGJHW x'HFHPEHU±ZLOODWWHQG%XVLQHVV&KDPSLRQVIRU<RXWKOXQFKHRQIURPDP± SPDW(GLQEXUJK86$&OXEKRXVHLQ%URRNO\Q3DUN x'HFHPEHU±ZLOODWWHQG&HQVXV&RPPXQLW\0HHWLQJDW1RUWKSRUW(OHPHQWDU\ 6FKRROIURPSP    '5$)7 &RXQFLOPHPEHU*UDYHVUHSRUWHGRQKHUDWWHQGDQFHDWWKHIROORZLQJDQGSURYLGHGLQIRUPDWLRQRQ WKHIROORZLQJXSFRPLQJHYHQWV x1RYHPEHU±XQDEOHWRDWWHQG3DUNDQG5HFUHDWLRQ&RPPLVVLRQPHHWLQJGXHWR&LW\ &RXQFLOPHHWLQJ x1RYHPEHU±PHWZLWK-HUHPLDK(OOLVRQQHZO\HOHFWHG0LQQHDSROLV&LW\ &RXQFLOPHPEHUUHSUHVHQWLQJ:DUG$OVRDWWHQGHG-DPDU&ODUNYLJLORQ3O\PRXWK$YHQXH x1RYHPEHU±PHWZLWK-LOOLD3HVVHQGD3ROLWLFDO'LUHFWRURI:RPHQ:LQQLQJ x1RYHPEHU±1RUWKVLGH8UEDQ&RDOLWLRQPHHWLQJRQWKHWRSLFRIRSLRLGDQGDOFRKRO DGGLFWLRQ x1RYHPEHU±PHWZLWK+HQQHSLQ&RXQW\&RPPLVVLRQHU0LNH2SDW x1RYHPEHU±DWWHQGHG%URRNO\QV<RXWK&RXQFLOPHHWLQJ x1RYHPEHU±PHWZLWK%URRNO\Q&HQWHU0D\RU(OHFW0LNH(OOLRWW x1RYHPEHU±WRXURI$ODWXVDSDUWPHQWGHYHORSPHQWLQ&U\VWDOZLWK&LW\&RXQFLO  &RXQFLOPHPEHU%XWOHUUHSRUWHGRQKHUDWWHQGDQFHDWWKHIROORZLQJDQGSURYLGHGLQIRUPDWLRQRQ WKHIROORZLQJXSFRPLQJHYHQWV x1RYHPEHU±+RXVLQJ&RPPLVVLRQPHHWLQJ x1RYHPEHU±WRXURI$ODWXVDSDUWPHQWGHYHORSPHQWLQ&U\VWDOZLWK&LW\&RXQFLO  0D\RU:LOOVRQUHSRUWHGRQKLVDWWHQGDQFHDWWKHIROORZLQJDQGSURYLGHGLQIRUPDWLRQRQWKH IROORZLQJXSFRPLQJHYHQWV x1RYHPEHU±SDUWLFLSDWHGLQ5RWDU\&OXE&KULVWPDV%HOO5LQJLQJDW&XE)RRGVLQ %URRNO\Q&HQWHU  0D\RU:LOOVRQUHPLQGHGUHVLGHQWVWKDWQRVWUHHWSDUNLQJZLOOEHDOORZHGZKHQWKHUHLVD VQRZIDOORI´RUPRUHWRDOORZIRUVQRZUHPRYDO4XHVWLRQVFDQEHGLUHFWHGWR&LW\6WDIIDW    $'-28510(17  &RXQFLOPHPEHU 5\DQ PRYHG DQG &RXQFLOPHPEHU *UDYHV VHFRQGHG DGMRXUQPHQW RI WKH &LW\ &RXQFLOPHHWLQJDWSP  0RWLRQSDVVHGXQDQLPRXVO\    '5$)7 0,187(62)7+(352&((',1*62)7+(&,7<&281&,/(&2120,& '(9(/230(17$87+25,7<2)7+(&,7<2)%522./<1&(17(5 ,17+(&2817<2)+(11(3,1$1' 7+(67$7(2)0,11(627$  :25.6(66,21 129(0%(5 &,7<+$//±&281&,/&+$0%(56 &$//7225'(5  7KH %URRNO\Q &HQWHU &LW\ &RXQFLO(FRQRPLF 'HYHORSPHQW $XWKRULW\ ( ' $ P H W L Q : R U N  6HVVLRQFDOOHGWRRUGHUE\0D\RU3UHVLGHQW7LP:LOOVRQDWSP  52//&$//  0D\RU3UHVLGHQW 7LP :LOOVRQ DQG&RXQFLOPHPEHUV&RPPLVVLRQHUV 0DUTXLWD %XWOHU $SULO *UDYHVDQG'DQ5\DQ&RXQFLOPHPEHU&RPPLVVLRQHU.ULV/DZUHQFH$QGHUVRQZDVDEVHQWDQG H[FXVHG  $OVR SUHVHQW ZHUH &LW\ 0DQDJHU &XUW %RJDQH\ 'HSXW\ &LW\ 0DQDJHU 5HJJLH (GZDUGV&RPPXQLW\'HYHORSPHQW'LUHFWRU0HJ%HHNPDQDQG0DU\0XOOHQ7LPH6DYHU2II 6LWH6HFUHWDULDO,QF  %522./<1%28/(9$5''(9(/230(17&21&(37352326$/  &RPPXQLW\'HYHORSPHQW'LUHFWRU0HJ%HHNPDQUHYLHZHGDSRWHQWLDOGHYHORSPHQWRSSRUWXQLW\ DW%URRNO\Q%RXOHYDUGDQGVW$YHQXH16KHQRWHGWKHGHYHORSHUZDVSUHVHQWDWWKHPHHWLQJ DVZHOODV6WDFLH.YLOYDQJIURP(KOHUV,QF7KHGHYHORSPHQWFRQFHSWUHYLHZSHUWDLQVWRWKUHH SURSHUWLHVRQWKHQRUWKZHVWFRUQHURIVW$YHQXHDQG%URRNO\Q%RXOHYDUGFXUUHQWO\YDFDQWDQG RZQHGE\WKH(FRQRPLF'HYHORSPHQW$XWKRULW\ ('$   0V%HHNPDQVWDWHGWKHSURSHUWLHVDUHLQ7,)'LVWULFW7,)GLVWULFWZDVFUHDWHGWRIDFLOLWDWHWKH QHDUE\GHYHORSPHQWRI7KH6DQFWXDU\6KHDGGHGDFRQFHSWZDVVXEPLWWHGIRUDIRXUVWRU\ PXOWLIDPLO\ GHYHORSPHQW WKDW ZRXOG EH DIIRUGDEOH WR SHRSOH ZLWKLQ  DUHD PHGLDQ LQFRPH  6KH QRWHG KRZHYHU WKH GHYHORSPHQW LV QRW FRQVLGHUHGOHJDOO\ ELQGLQJ DIIRUGDEOH KRXVLQJ  0D\RU3UHVLGHQW:LOOVRQDVNHGZKHWKHUKRXVLQJFDQEHERWKDIIRUGDEOHDQGPDUNHWUDWH0V %HHNPDQVWDWHGWKHFXUUHQWDYHUDJHPDUNHWUDWHLQ%URRNO\Q&HQWHUIRUPXOWLIDPLO\KRXVLQJLV DIIRUGDEOHWRUHQWHUVZLWKRIWKHDUHDPHGLDQLQFRPH6KHDGGHGUHQWDOEXLOGLQJVLQ %URRNO\Q&HQWHUDUHJHQHUDOO\ROGDQGQDWXUDOO\UHQWIRUOHVVZKLOHQHZGHYHORSPHQWVZRXOG KDYHKLJKHUUHQWOHYHOV6KHDGGHGWKHTXDOLW\RIPDWHULDOVLVWKHVDPHDVRWKHUQHZFRQVWUXFWLRQ SURMHFWVEXWXQLWVDUHVOLJKWO\VPDOOHUDQGVRPHDPHQLWLHVDUHQRWLQFOXGHG    '5$)7 0V%HHNPDQVWDWHGWKHUHQWVDUHDQWLFLSDWHGWREHLQWKHSHUVTXDUHIRRWUDQJH6KHDGGHGWKH SURSRVHGGHYHORSPHQWZRXOGTXDOLI\IRU7D[,QFUHPHQW)LQDQFLQJ 7,) DVWKHVWXGLRXQLWVPHHW WKH0HWURSROLWDQ&RXQFLO¶VDIIRUGDELOLW\UHTXLUHPHQWRIRIWKH$UHD0HGLDQ,QFRPH $0,   0D\RU3UHVLGHQW:LOOVRQVWDWHGDVWXGLRDSDUWPHQWPD\EHDIIRUGDEOHEXWLWLVQRWDIDPLO\  DSDUWPHQW  0V %HHNPDQ DJUHHG DGGLQJ D VWXGLR DSDUWPHQW ZRXOG EH DSSURSULDWH IRU DQ LQGLYLGXDO6KHDGGHGWKHSURSRVHGGHYHORSPHQW¶VEHGURRPXQLW6ZRXOGEHDSSURSULDWHIRUD IDPLO\RIIRXU6KHVWDWHGWKHDIIRUGDELOLW\FULWHULDDGMXVWVEDVHGRQIDPLO\VL]H  0V%HHNPDQVWDWHGSURMHFWFRVWVZLOOEHHYDOXDWHGDVWKHUHYLHZPRYHVIRUZDUG6KHDGGHG WKHUHLVDJDSRIPLOOLRQLQFOXGLQJPLOOLRQIRUXQGHUJURXQGSDUNLQJ7KHGHYHORSPHQW SURMHFWGRHVQRWQHHGWRPHHWWKHVDPHLQIUDVWUXFWXUHHOLJLEOHFRVWVDVDUHGHYHORSPHQW7,) GLVWULFWDVWKHUHLVDORZHUWKUHVKROGIRUKRXVLQJ7,)GLVWULFWV  0D\RU3UHVLGHQW:LOOVRQVWDWHGWKH7,)GLVWULFWLVJHQHUDOO\\HDUVZKLFKLVQRWHQRXJKWLPH WRSD\EDFNPLOOLRQZLWKHVWLPDWHGWD[HVDW0V%HHNPDQVWDWHGWKHGHYHORSHU ZLOO DSSO\ IRU SXEOLF VXEVLG\ ZKLFK ZLOO LQFOXGH D UHYLHZ E\ WKH ('$¶V SXEOLF ILQDQFH FRQVXOWDQW6KHDGGHGDKRXVLQJ7,)GLVWULFWFDQJRXSWR\HDUVZKLFKZRXOGFUHDWHPRUH LQFUHPHQW  &RXQFLOPHPEHU&RPPLVVLRQHU5\DQVWDWHGDFFRUGLQJWRWKH&LW\¶V&RPPXQLW\'HYHORSPHQW 'LUHFWRUQHZPXOWLIDPLO\KRXVLQJFRQVWUXFWLRQJHQHUDOO\ZDUUDQWVJRYHUQPHQWDVVLVWDQFH0V %HHNPDQ DJUHHG DGGLQJ PDQ\ IDFWRUV FRQWULEXWH WR WKH KLJK FRVW RI QHZ PXOWLIDPLO\ GHYHORSPHQWLQFOXGLQJFRQVWUXFWLRQFRVWVODQGYDOXHDQGGHPDQG  &RXQFLOPHPEHU&RPPLVVLRQHU 5\DQ VWDWHG WKH GHYHORSHU FRXOG WU\WR XVH DV PXFK VXUIDFH SDUNLQJDVSRVVLEOHWRPLQLPL]HWKHFRVWRIVWUXFWXUH'SDUNLQJ+HDGGHGWKH&LW\&RXQFLO YLVLWHGWKH$ODWXVKRXVLQJGHYHORSPHQWLQ1HZ+RSHWKDWGD\DQGXQGHUJURXQGSDUNLQJLVWKH PRVWH[SHQVLYHW\SHRISDUNLQJ0V%HHNPDQDJUHHGDGGLQJSDUNLQJDWWKDWIDFLOLW\LV SHUVWDOO  0D\RU3UHVLGHQW:LOOVRQDVNHGZKDWOLDELOLW\WKH&LW\ZRXOGKDYHLIWKHUHLVDQDWXUDOGLVDVWHU DQGWKHEXLOGLQJQRORQJHUJHQHUDWHVIXQGVWRSD\RIIWKH7,)GLVWULFW  6WDFLH.YLOYDQJ(KOHUV,QF5RVHYLOOHVWDWHGLQDQVZHUWR0D\RU3UHVLGHQW:LOOVRQ¶VTXHVWLRQ 7,)LVRQO\JHQHUDWHGZLWKDSD\DV\RXJRQRWHDQGWKH&LW\ZRXOGKDYHQRREOLJDWLRQWRPDNH SD\PHQWV LQ WKH HYHQW RI QDWXUDO GLVDVWHU  6KH DGGHG LW LV WKH ULVN RI WKH GHYHORSHU ZKR JXDUDQWHHVUHSD\PHQWWRWKHEDQN7KHWD[LQFUHPHQWSD\PHQWRIIWKHWD[EDVLVLVWKH&LW\¶VRQO\ REOLJDWLRQ  0V%HHNPDQVWDWHGEDVHGRQWKLVHYHQLQJ¶VGLVFXVVLRQWKHUHDUHSRWHQWLDOFRPSRQHQWVWRDQ DSSOLFDWLRQ WR SURFHHG ZLWK WKH GHYHORSPHQW  7KH GHYHORSHU ZLOO VXEPLW D SXEOLF VXEVLG\ UHTXHVW ZKLFK ZLOO LQFOXGH D UHYLHZ E\ WKH &LW\¶V FRQVXOWDQWWKH &LW\ DQG WKH (FRQRPLF   '5$)7 'HYHORSPHQW$XWKRULW\ ('$ 7KHGHYHORSHUZLOOSUHVHQWWKHLUSODQVWR3ODQQLQJ&RPPLVVLRQ WRFRQILUPWKDWWKHLUSURSRVDOLVLQOLQHZLWKWKH&RPSUHKHQVLYH3ODQDQGWKHQWKHSODQVZLOOEH SUHVHQWHGWRWKH&LW\&RXQFLODQG('$  0V %HHNPDQ VWDWHG WKH ('$RZQHG SURSHUW\ VDOH ZRXOG PRYH IRUZDUGZLWKDSUHOLPLQDU\ GHYHORSPHQWDJUHHPHQWVRWKHGHYHORSHUZRXOGKDYHWKHSURSHUW\XQGHUFRQWUDFW6KHDGGHG WKLVPXVWEHDSSURYHGE\WKH('$DQGDSXEOLFKHDULQJLVUHTXLUHGWRILQDOL]HWKHVDOHRIWKH SURSHUW\6KHQRWHGWKHUHLVWKHSRVVLELOLW\RID&RPSUHKHQVLYH3ODQDPHQGPHQWDOWKRXJKVKHLV XQVXUHKRZDQDPHQGPHQWUHTXHVWZRXOGEHKDQGOHGDVWKH0HWURSROLWDQ&RXQFLOVWRSVWDNLQJ DPHQGPHQWUHTXHVWVDWWKHHQGRIWKLV\HDU  0V%HHNPDQVWDWHGWKHGUDIW3ODQKDVEHHQVXEPLWWHGWRWKH0HWURSROLWDQ&RXQFLOIRU SUHOLPLQDU\UHYLHZDQGLQFOXGHVJXLGHOLQHVIRUPXOWLIDPLO\GHYHORSPHQW6KHDGGHGKRZHYHU WKLVSURSRVHGGHYHORSPHQWZRXOGUHTXLUHDQDPHQGPHQWWKDWLVPRUHLQOLQHZLWKWKHIXWXUH &RPSUHKHQVLYH3ODQ  0D\RU3UHVLGHQW:LOOVRQVWDWHGWKH0HWURSROLWDQ&RXQFLOZLOOKDYHWRFRQVLGHU&RPSUHKHQVLYH 3ODQGUDIWFKDQJHVXSXQWLO$SULO  0V %HHNPDQ VWDWHG WKH WKUHH SDUFHOV LQ TXHVWLRQ DUH ZLWKLQ WKH %URRNO\Q %RXOHYDUG 5HFRQVWUXFWLRQ$UHDWKH&LW\LVDFWLYHO\HQJDJHGLQDFTXLULQJVLQJOHIDPLO\SURSHUWLHVLGHQWLILHG IRUKLJKLQWHQVLW\XVH6KHDGGHGWKLVDUHDDOVRIDOOVZLWKLQWKH%URRNO\Q%RXOHYDUG2YHUOD\ 'LVWULFW  0D\RU3UHVLGHQW :LOOVRQ VWDWHG WKH 2YHUOD\ 'LVWULFW VKRXOG EH UHYLHZHG E\ WKH 3ODQQLQJ &RPPLVVLRQVRWKDWWKLVW\SHRIGHYHORSPHQWLVDOORZHGDORQJ%URRNO\Q%RXOHYDUG  3DWULFN&UXLNVKDQNDQG-DFNVRQ&UXLNVKDQN7+25/LYLQJ3HQQ$YHQXH0LQQHDSROLV VWDWHG7+25/LYLQJLVDPLQRULW\RZQHGFRQVWUXFWLRQGHVLJQDQGGHYHORSPHQWILUPIRFXVHGRQ KRXVLQJZLWKDPLFURIRFXVRQDWWDLQDEOHKRXVLQJ+HDGGHGWKLVGHYHORSPHQWLVPDUNHWUDWH KRXVLQJEXWLWLVDOVRUHIHUUHGWRDVDWWDLQDEOHRUZRUNIRUFHKRXVLQJ  0D\RU3UHVLGHQW :LOOVRQ DVNHG ZKHWKHU D ZDJH VFDOH LV DYDLODEOHI R U W K H G H Y H O R S P H Q W ¶ V  HPSOR\HHV0U&UXLNVKDQNVWDWHGWKHSURSHUW\PDQDJHPHQWZLOOEHUHVSRQVLEOHIRUWKHZDJH VFDOH  0D\RU3UHVLGHQW :LOOVRQ UHTXHVWHG WKDW WKH ZDJH VFDOH ZKHQ LWLV GHWHUPLQHG VKRXOG EH LQFOXGHGLQWKHGHYHORSHUDJUHHPHQWZKHQLWLVQHJRWLDWHG  &LW\0DQDJHU&XUW%RJDQH\VWDWHGFHUWDLQSURMHFWVDUHUHTXLUHGWRKDYHDVXEVLG\DJUHHPHQWZLWK WKH&LW\WRLGHQWLI\WKHQXPEHURIMREVDQGZDJHUDWHV+HDGGHGDWDUHFHQW:RUN6HVVLRQWKH &LW\&RXQFLO('$KDGGLVFXVVHGWKHLPSRUWDQFHRIXSJUDGLQJWKHVXEVLG\SROLF\¶VZDJHVHFWLRQ   '5$)7 +HDGGHGWKLVUHSUHVHQWVDQRSSRUWXQLW\WRFKDQJHWKHPLQLPXPZDJHUHTXLUHPHQW+HQRWHG TXDOLI\LQJGHYHORSHUVZRXOGEHREOLJDWHGWRPHHWWKRVHVWDQGDUGV  &RXQFLOPHPEHU&RPPLVVLRQHU 5\DQ DVNHG UHJDUGLQJ GHQVLW\ ZKHWKHU WKH QXPEHU RI XQLWV FRXOGEHLQFUHDVHGWRSURYLGHDPRUHIDYRUDEOHFRVWSHUXQLW+HDVNHGZKHWKHUPRUHWKDQ XQLWVLVDSRVVLELOLW\  0U&UXLNVKDQNVWDWHGWKHGHQVLW\LVOLPLWHGE\SDUNLQJ+HDGGHGLWZRXOGEHGLIILFXOWWRDGG PRUHVXUIDFHSDUNLQJ+HQRWHGDQXQGHUJURXQGSDUNLQJVWDOOLVHVWLPDWHGWRFRVWWR EXLOG  0D\RU3UHVLGHQW:LOOVRQVWDWHGWKHUHZRXOGEHDQRSSRUWXQLW\IRUPRUHXQGHUJURXQGSDUNLQJLI WKHEXLOGLQJZDVORQJHU0U&UXLNVKDQNVWDWHGWKHSURSRVHGVXUIDFHSDUNLQJZRXOGEHORVW ZKLFKZRXOGUDLVHWKHSULFHRIFRQVWUXFWLRQ+HDGGHGWKHFXUUHQWEDODQFHZRUNVEXWWKH\DUH ZLOOLQJWRORRNDWGLIIHUHQWRSWLRQV+HSUHVHQWHGDYDULHW\RIFRQFHSWGUDZLQJVIRUWKH&LW\ &RXQFLO('$¶VUHYLHZDQGGLVFXVVLRQ  0D\RU3UHVLGHQW:LOOVRQDVNHGZKHWKHUWKHUHZLOOEHVFUHHQLQJRQWKHZHVWHGJHRIWKHSDUNLQJ DUHD0U&UXLNVKDQNDJUHHGWRUHYLHZWKDWLVVXH  0D\RU3UHVLGHQW:LOOVRQVWDWHGKHDSSUHFLDWHVWKDW7+25/LYLQJLVLQWHUHVWHGLQGHYHORSLQJWKLV SURSHUW\DQGKHWKDQNHGWKHGHYHORSPHQWFRPSDQ\IRUWKHLUHIIRUWVLQKHOSLQJWKH&LW\LPSURYH DQGJURZWKLVDUHD  0D\RU3UHVLGHQW:LOOVRQVWDWHGWKHGHYHORSPHQWSURMHFWVRXQGVIHDVLEOHWKHUHLVDQHHGIRULW DQGKHZRXOGOLNHWRVHHLWPRYHIRUZDUG  &RXQFLOPHPEHU&RPPLVVLRQHU5\DQVWDWHGKHEHOLHYHVWKHUHZRXOGEHSXVKEDFNDERXWD VWRU\GHYHORSPHQW+HDGGHGWKHUHLVRQO\VRPXFKURRPIRUVHUYLFHSDUNLQJ+HQRWHGKHLV SOHDVHGWRVHHWKLVSODQDQGKHZRXOGOLNHWRVHHLWPRYHIRUZDUGWREHFRPHDPRUHVSHFLILF SURSRVDO  &RXQFLOPHPEHU&RPPLVVLRQHU5\DQVWDWHGKHLVKRSHIXOWKDW2SSRUWXQLW\=RQHOHJLVODWLRQZLOO FUHDWHLQFHQWLYHVIRUGHYHORSHUV  &RXQFLOPHPEHU&RPPLVVLRQHU *UDYHV H[SUHVVHG FRQFHUQ WKDW ³DWWDLQDEOH´ KRXVLQJ LV VWLOO H[SHQVLYH6KHDVNHGKRZWKHGHYHORSPHQWPHHWV³DIIRUGDELOLW\´VWDQGDUGVZKHQRQO\WKH SHUVRQVWXGLRXQLWVIDOOEHORZWKH$0,UHTXLUHPHQW  0U&UXLNVKDQNVWDWHGPRVWXQLWVDUHEHWZHHQ$0,ZKLFKTXDOLILHVWKHPIRUDIIRUGDEOH KRXVLQJ+HDGGHGRIXQLWVQHHGWRIDOOXQGHUWKH$0,WKUHVKROGDQGQRQHRIWKHXQLWV DUHDERYH$0,    '5$)7 &RXQFLOPHPEHU&RPPLVVLRQHU *UDYHV VWDWHG VKH OLYHV DFURVV WKH VWUHHW IURP WKH SURSRVHG GHYHORSPHQWDQGZDWFKHGWKH6DQFWXDU\EHLQJ EXLOW6KHDGGHGVKH UHDOL]HV KRZ ORQJ WKH SURFHVVWDNHV6KHQRWHGDQDSDUWPHQWEXLOGLQJRQKHUEORFNKDVKLJKUHQWVDQGLWLVDQROGHU EXLOGLQJ6KHH[SUHVVHGKHUVXSSRUWRIPRUHDWWDLQDEOHKRXVLQJDQGVKHLVLPSUHVVHGE\WKH ZRUNRI7+25/LYLQJ  &RXQFLOPHPEHU&RPPLVVLRQHU5\DQVWDWHGWKH&LW\&RXQFLOKDVGLVFXVVHGWKLVGHYHORSPHQWDV ³ZRUNIRUFH´KRXVLQJZKLFKLGHQWLILHVWKHFRQFHSWDQGSULFHUDQJH0U&UXLNVKDQNDJUHHG  &RXQFLOPHPEHU&RPPLVVLRQHU %XWOHUVWDWHG WKHUH ZDV GLVFXVVLRQ DERXW UHVLGHQWV RI WKH 6DQFWXDU\FURVVLQJ%URRNO\Q%RXOHYDUGRQIRRWWRJHWWRWKHJDVVWDWLRQ6KHDVNHGZKHWKHU WKHUHDUHDQ\FRQFHUQVDERXWSHGHVWULDQWUDIILFDQGZKHWKHUWKH&LW\KDVSODQVWRGRVRPHWKLQJDW WKLVLQWHUVHFWLRQ  0V%HHNPDQVWDWHGDWUDIILFVWXG\ZRXOGEHFRPSOHWHGDVSDUWRIWKHSURMHFWZKLFKZRXOG LQFOXGHDFFHVVSRLQWV6KHDGGHG3XEOLF:RUNV'HSDUWPHQWLVDZDUHRIWKHLQWHUVHFWLRQDQGKDYH FRPPHQWHGRQWKHVLWHSODQ6KHQRWHGWKHSODQQHGURDGZD\LPSURYHPHQWVZLOOFUHDWHPXFK VDIHUDFFHVV  0D\RU3UHVLGHQW :LOOVRQ VWDWHG WKH &LW\ &RXQFLO('$ PD\ ZLVK WR FRQVLGHU D SHGHVWULDQ RYHUSDVVDWWKLVORFDWLRQ+HDGGHGKHZRXOGQRWVXSSRUWDVWRSOLJKWDWWKHLQWHUVHFWLRQ+H QRWHG+HQQHSLQ&RXQW\RUWKH6WDWHRI0LQQHVRWDPD\EHZLOOLQJWRZRUNZLWKWKH&LW\RQD VROXWLRQ  &RXQFLOPHPEHU&RPPLVVLRQHU *UDYHV VWDWHG VKH WKRXJKW WKHUH ZHUH FHQWHU PHGLDQV LQ WKH FRQFHSWSODQ0D\RU3UHVLGHQW:LOOVRQVWDWHGWKHUHDUHPHGLDQVLQWKHSODQKRZHYHUWKH\RQO\ JHW SHGHVWULDQV KDOIZD\ DFURVV %URRNO\Q %RXOHYDUG  0U %RJDQH\ VWDWHG WKH FUHDWLRQ RI SHGHVWULDQVDIH]RQHVLVDJRDORIWKLVSURMHFW  7KHPDMRULW\FRQVHQVXVRIWKH&LW\&RXQFLO('$ZDVWRLQVWUXFW&LW\6WDIIWRPRYHIRUZDUGZLWK WKH SURSRVHG SURMHFW DQG SURYLGH WKH &LW\ &RXQFLO('$ ZLWK GHWDLOHG SODQV WKURXJKRXW WKH SURFHVV  $'-28510(17  &RXQFLOPHPEHU&RPPLVVLRQHU 5\DQ PRYHG DQG &RXQFLOPHPEHU&RPPLVVLRQHU %XWOHU VHFRQGHGDGMRXUQPHQWRIWKH&LW\&RXQFLO(FRQRPLF'HYHORSPHQW$XWKRULW\:RUN6HVVLRQDW SP  0RWLRQSDVVHGXQDQLPRXVO\  12/03/18 -1- DRAFT MINUTES OF THE PROCEEDINGS OF THE CITY COUNCIL OF THE CITY OF BROOKLYN CENTER IN THE COUNTY OF HENNEPIN AND THE STATE OF MINNESOTA SPECIAL MEETING DECEMBER 3, 2018 CITY HALL – COUNCIL CHAMBERS 1. CALL TO ORDER The Brooklyn Center City Council met in Special Meeting called to order by Mayor Tim Willson at 7:00 p.m. 2. ROLL CALL Mayor Tim Willson and Councilmembers Kris Lawrence-Anderson and Dan Ryan. Councilmember April Graves and Marquita Butler were absent and excused. Also present were City Manager Curt Boganey, Finance Director Nate Reinhardt, and Mary Mullen, TimeSaver Off Site Secretarial, Inc. 3. CONSIDERATION OF 2019 BUDGET AND PUBLIC HEARING Finance Director Nate Reinhardt reviewed the City budget process to provide the general public with information on the 2019 proposed budget and tax levy prior to their adoption. He added budget planning include a series of Joint Budget Study Sessions with the City Council and Financial Commission. He noted the strategic priorities of the 2019 Budget include economic stability, redevelopment, and community engagement. Mr. Reinhardt reviewed 2019 the proposed levy in comparison to the Statewide average. He added the comparison is favorable, although the City’s levy is slightly higher than average. He noted the proposed levy is driven by limited growth in non-property tax revenue and an increase in City personnel and infrastructure costs. Mr. Reinhardt stated costs related to Personnel include a 3% base wage increase for all City employees, as well as the addition of staff. He added these additions include an Engineering Technician, Building Inspector, Community Engagement Specialists, as well as a part-time Human Resources Specialist and part-time youth recreational programming staff. Mr. Reinhardt stated Capital Improvement projects identified in the budget include public utilities, street improvements, parks improvements and capital maintenance building improvements. Mr. Reinhardt stated residential property taxes can change based on the value of the property or Brooklyn Center property values, as well as General Fund operational costs. 12/03/18 -2- DRAFT Mr. Boganey stated residential and multi-family apartment values are increasing at almost twice the rate of all other values or uses. Mr. Reinhardt reviewed property tax increases on the City’s median value home, or the home at which 50% of property values are higher and 50% are lower. He added the median home value would see a 4.4% tax increase even if the City Council adopts a zero-increase budget. He noted any questions or comments related to residential property values should be directed to City Staff or the Hennepin County Assessor, Josh Whitney. Mr. Boganey stated the Board of Appeal and Equalization hearing will be held in the spring 2019, at which residents have an opportunity to contest their property values. He added individual property values will not be addressed at tonight’s Budget Hearing. Councilmember Ryan stated the median residential property value of $184,000 represents a 10% increase, or $123 per year, over last year. He added some properties have higher values, including properties on the river or on Twin Lake, as Assessor standards tend to raise those types of property values. Mr. Boganey stated those properties tend to have a higher value because of their location, that is easier to retain and increases at a faster rate than other properties. Councilmember Ryan moved and Councilmember Lawrence-Anderson seconded to open the Public Hearing at 7:24 p.m. Motion passed unanimously. Gary Brown, 7012 Willow Lane, stated his residential property is on the river. He added he sees stores continually closing and commercial property being taken down. He added the Community Development budget has risen over 14%. Mayor Willson stated major commercial development will occur in Brooklyn Center during the next two years on significant pieces of property. Mr. Brown stated he thinks the increase in his property value is reasonable. He added, however, there seems to be very little being done about commercial development in Brooklyn Center. Councilmember Ryan stated he appreciates Mr. Brown’s comments. He added Brooklyn Center’s budget and expenses are like many communities across the Midwest, especially considering the recent recession. He noted he has challenged the City’s Community Development Department to continue to be proactive. Councilmember Ryan stated the City has entered into a preliminary development agreement with Alatus LLC for a $200 million residential project on 35 acres within the City’s Opportunity Site. 12/03/18 -3- DRAFT Scott Terhaar, 7216 Riverdale Road, stated he questions the assessed value of his home. He added he did some research and Brooklyn Center has the highest effective tax rate out of the 40 cities he researched. He noted his property value and taxes have gone up in the past two years, and it is difficult to see residents taking on an increased tax burden. He expressed concern that higher property taxes will decrease the value of his home. Cindy Roberts, 6442 Lee Avenue North, stated her property value increased by 20%, although that increase in value is not realized unless they sell their home. She added there are no increases in wages happening at her home. Tim Haroldson, 1207 72nd Avenue North, stated he loves the fact that his property value increased by 19.7%. He asked why an Engineering Technician is being added to City Staff, as well as a third Building Inspector. He asked why the City needs additional Community Engagement staff. Mayor Willson stated these Engineering Technician and Building Inspector staff are vital positions, and are busy working on various projects. He added the increased Community Engagement staff is part of a recent City-wide initiative to reach out to residents in our diverse community. The goals of this important initiative are an increased sense of community and improved involvement within Brooklyn Center. Mr. Haroldson stated he feels like there is more crime, and he would like to see some focus on issues and projects that are not getting completed. He added he appreciates the hard work of the City Council. He reiterated his concern regarding the staff salaries presented in the 2019 Budget. Mayor Willson recommended that Mr. Haroldson submit an application for the Financial Commission, which currently has two openings. Councilmember Lawrence-Anderson moved and Councilmember Ryan seconded to close the Public Hearing at 7:41 p.m. Motion passed unanimously. Mr. Boganey expressed his appreciation of the resident comments expressed during the public hearing. He added many commercial developments have been approved and are in planning stages, including a new Casey’s Store, and two new sites are under construction: a commercial storage facility and a new hotel next to Embassy Suites. He noted a residential development project with 35 new single-family homes has also been approved and construction is planned for next fall, as well as a multi-family residential development at the Opportunity Site. Mr. Boganey stated Brooklyn Center’s residents will see many new redevelopment projects. He noted Brooklyn Center was one of the metropolitan area communities where, during the 12/03/18 -4- DRAFT recession, property values fell the quickest and deepest. Other second-ring suburbs began to recover their values sooner, but Brooklyn Center is now experiencing an increasingly faster growth rate because of the low cost of quality homes in the area. The demand for commercial as well as residential property in Brooklyn Center is high as developers continue to look for the next best opportunity. Mr. Boganey thanked the residents who came to tonight’s meeting and expressed his confidence and excitement regarding development and growth in Brooklyn Center over the next three years. Councilmember Ryan stated the burden of property taxes falls most heavily on those least able to pay. He added he is retired, on a fixed income, and does not have a pension, and he is averse to raising taxes. He added the City is called upon to provide services to its residents, including community outreach, which is extremely important for communication and community-building. Mayor Willson thanked the residents who came to the meeting and shared their thoughts and comments. 4. CITY MANAGER’S BUDGET TRANSMITTAL LETTER FOR 2019 FISCAL YEAR Councilmember Lawrence-Anderson moved, and Councilmember Ryan seconded to accept the City Manager’s Budget Transmittal Letter for 2019 Fiscal Year. Motion passed unanimously. 5. RESOLUTION NO. 2018-202 APPROVING FINAL TAX CAPACITY LEVIES FOR THE GENERAL FUND AND DEBT SERVICE FUNDS AND MARKET VALUE TAX LEVY FOR THE HOUSING AND REDEVELOPMENT AUTHORITY FOR PROPERTY TAXES PAYABLE IN 2019 Councilmember Ryan moved, and Councilmember Lawrence-Anderson seconded to adopt RESOLUTION NO. 2018-202 approving Final Tax Capacity Levies for the General Fund and Debt Service Funds and Market Value Tax Levy for the Housing and Redevelopment Authority for Property Taxes Payable in 2019. Motion passed unanimously. 6. RESOLUTION NO. 2018-203 ADOPTING THE 2019 ANNUAL CITY BUDGET Councilmember Lawrence-Anderson moved, and Councilmember Ryan seconded to adopt RESOLUTION NO. 2018-203 adopting the 2019 Annual City Budget. Motion passed unanimously. 12/03/18 -5- DRAFT 7. RESOLUTION NO. 2018-204 APPROVING THE 2019-2033 CAPITAL IMPROVEMENT PLAN AND ADOPTING THE 2019 CAPITAL PROGRAM Councilmember Ryan moved, and Councilmember Lawrence-Anderson seconded to adopt RESOLUTION NO. 2018-204 approving the 2019-2033 Capital Improvement Plan and Adopting the 2019 Capital Program. Motion passed unanimously. 8. ADJOURNMENT Councilmember Lawrence-Anderson moved and Councilmember Ryan seconded to close the Special Session at 7:57 p.m. Motion passed unanimously.                 ! "#   $  %& '   () &*  ##+(,-'""             .,((!% """"#"".+##( , ('""" '.% """#".", (,(( ./ 0",.   '+"#'+('""" %0 #####('" # ##,"  ##('",( !((('""'0#('!. .#,.   ,  '" (""'00" %(!.## "".'. (# !! "#$$%& !%'  .(/ ('"!("%" #"#''", "'/ 0" 0/  0 0.,    ( ) *+ + , 1''$!)" #(, 23 4 0 + '0%5    .  - + + & +  + + ( &""-- 3 22.+ )( 6635   . //+  0'1   . 7" %7"&#  &.( ) "" )( 6635  .#(8'((69:8"+4 )( 6635 +";' %+"1<<=" 6>59& 00 )( 6635 " -- %"  2 > &.( )1)! )( 6635  . //+    "." %0'-1"25  2 )((+  )( 663>  . //+  2 -  +0 %"%(+  $!(+ )( 6635 ##("-- %##(%?"4.%. ((= 3 &.( ) "" )( 6635 )((1"-- %0%""& " 25 (! )( 6635 $();( # %(!  266(!+ )( 6635 *0%,';' *0%,'"   2 $!(+ )( 6635 #(,& %#(, 23  0 +4 )( 6635  . //+  + ,  +0 %"%(+  $!(+ )( 6635 ##("-- %##(%?"4.%. ((= 3 &.( ) "" )( 6635 )((1"-- %0%""& " 25 (! )( 6635  "." %0'-1"25 2 )((+ )( 663> $();( # %(!  266(!+ )( 6635 *0%,';' *0%,' 2 $!(+ )( 6635 #(,& %#(, 23  0 +4 )( 6635  . //+  ) )( " ;' %6 ?"(( 663)((+ )( 663> +";' %+"1<<=" 6>59& 00 )( 6635 " -- %"  2 > &.( )1)! )( 6635  3    + = @ ;'295 3 +47 -)4665 > &'.'(-- 96!+ 0(6653 &1 (1( 0%= 23  + &1 (66 6    *0%,' 2 0+ &1 (66 5 *00?7"6> $!(+ )( 6635   +-   &"=#.'" 2 0+ &1 (66 5 -&";'2567('0+4 )(1)663>     + ( &""-- 3 22.+4 )( 6635 ( &""-- 2 > &.( )1)! )( 6635 4.(-- %&# !A5> 2>6 )((+ )( 663> 4.(-- %&# !A3 6 > 69.+4 )( 6635 4.(-- %&# !32 26367"+ )( 6635 (%''626:8"+4 )( 6635 7(0;'   &.( )1)! )( 6635 +& &,&' &%( 00  #(8'((' COUNCIL ITEM MEMORANDUM Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment Rental License Category Criteria Policy – Adopted by City Council 09-10-2018 Property Code and Nuisance Violations Criteria License Category (Based on Property Code Only) Number of Units Property Code Violations per Inspected Unit Type I – 3 Year 1-2 units 0-2 3+ units 0-0.75 Type II – 2 Year 1-2 units Greater than 2 but not more than 5 3+ units Greater than 0.75 but not more than 1.5 Type III – 1 Year 1-2 units Greater than 5 but not more than 9 3+ units Greater than 1.5 but not more than 3 Type IV – 6 Months 1-2 units Greater than 9 3+ units Greater than 3 License Category Number of Units Validated Calls for Disorderly Conduct Service & Part I Crimes (Calls Per Unit/Year) No Category Impact 1-2 0-1 3-4 units 0-0.25 5 or more units 0-0.35 Decrease 1 Category 1-2 Greater than 1 but not more than 3 3-4 units Greater than 0.25 but not more than 1 5 or more units Greater than 0.35 but not more than 0.50 Decrease 2 Categories 1-2 Greater than 3 3-4 units Greater than 1 5 or more units Greater than 0.50 Wƌ Ž Ɖ Ğ ƌ ƚ LJ   Ě Ě ƌ Ğ Ɛ Ɛ ǁ Ğ ů ů ŝ Ŷ Ő dLJ Ɖ Ğ ZĞ Ŷ Ğ ǁ Ă ů Žƌ  / Ŷ ŝ ƚ ŝ Ă ů Kǁ Ŷ Ğ ƌ Wƌ Ž Ɖ Ğ ƌ ƚ LJ Ž Ě Ğ sŝ Ž ů Ă ƚ ŝ Ž Ŷ Ɛ >ŝ Đ Ğ Ŷ Ɛ Ğ dLJ Ɖ Ğ WŽ ů ŝ Đ Ğ & ^  Ύ &ŝ Ŷ Ă ů  >ŝ Đ Ğ Ŷ Ɛ Ğ  dLJ Ɖ Ğ  Ύ Ύ Wƌ Ğ ǀ ŝ Ž Ƶ Ɛ  >ŝ Đ Ğ Ŷ Ɛ Ğ  dLJ Ɖ Ğ  Ύ Ύ Ύ ϲϯ ϯ ϭ   Ğ Ă ƌ Ě   ǀ Ğ  E dŚ Ğ   ǀ Ğ Ŷ Ƶ Ğ   Ɖ ƚ Ɛ ϯ  ů Ě Ő ϯϲ  Ƶ Ŷ ŝ ƚ Ɛ ZĞ Ŷ Ğ ǁ Ă ů   & /  , Ž ů Ě ŝ Ŷ Ő  > >  ϭϳ ͘ϰ ϳ ͬ Ƶ Ŷ ŝ ƚ / ϰ ǀ Ă ů ŝ Ě ͕  ϱ ͬ ϭ ϴ ͬ ϭ ϴ  Ě ŝ Ɛ ƚ Ƶ ƌ ď ŝ Ŷ Ő  ƉĞ Ă Đ Ğ ͕  ϵ ͬ ϲ ͬ ϭ ϴ  ƚ Ś Ğ Ĩ ƚ  Ĩ ƌ Ž ŵ  ĂƵ ƚ Ž ͕  ϵ ͬ ϭ ϴ ͬ ϭ ϴ  Ě ŝ Ɛ ƚ Ƶ ƌ ď ŝ Ŷ Ő  ƉĞ Ă Đ Ğ ͕  ϭ ϭ ͬ ϰ ͬ ϭ ϴ  Ě ŝ Ɛ ƚ Ƶ ƌ ď ŝ Ŷ Ő  ƉĞ Ă Đ Ğ ϰϮ Ϭ ϰ  > Ă Ŭ Ğ ď ƌ Ğ Ğ nj Ğ   ǀ Ğ ϭ  ů Ě Ő ϰ Ƶ Ŷ ŝ ƚ Ɛ ZĞ Ŷ Ğ ǁ Ă ů d Ž Ě Ě   Ğ ƌ ƚ ů Ğ Ɛ Ž Ŷ ͬ  W W ϯ  > >  ϭϮ ϯͬ Ƶ Ŷ ŝ ƚ // / Ϭ / / / / / / ϱϯ Ϭ ϭ  Z Ƶ Ɛ Ɛ Ğ ů ů   ǀ Ğ  E Ϯ  ů Ě Ő ϯϲ  Ƶ Ŷ ŝ ƚ Ɛ ZĞ Ŷ Ğ ǁ Ă ů E Ğ Ě nj Ă Ě   Ğ ƌ ŝ Đ ϯϬ ϱ ϴ͘ ϰ ϳ ͬ Ƶ Ŷ ŝ ƚ /s ϲͬ ϭ ϴ ͬ ϭ ϴ ƚŚ Ğ Ĩ ƚ /s / s ϲϮ Ϯ ϭ  ^ Ś ŝ Ŷ Ő ů Ğ   ƌ Ğ Ğ Ŭ  W Ŭ ǁ LJ ƌ Ğ Ɛ ƚ   Ɖ Ă ƌ ƚ ŵ Ğ Ŷ ƚ Ɛ ϭ  ů Ě Ő ϭϮ Ϯ  Ƶ Ŷ ŝ ƚ Ɛ ZĞ Ŷ Ğ ǁ Ă ů ^ ƚ Ğ ǀ Ğ Ŷ  W ů Ž ƚ nj ϳϮ ͘ϱ ϵ ͬ Ƶ Ŷ ŝ ƚ / ϭϮ ͘Ϭ ϵ ͬ Ƶ Ŷ ŝ ƚ // Ϯϭ ϭ ϯ  ϱ ϱ ƚ Ś   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů / Ŷ ǀ ŝ ƚ Ă ƚ ŝ Ž Ŷ  , Ž ŵ Ğ Ɛ ϭ / Ϭ / / / / ϯϴ ϭ ϴ  ϲ ϭ Ɛ ƚ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů ^ Ś Ğ ƌ ŵ Ă Ŷ  z ŝ Ś  & Ğ Ŷ Ő  < Ś Ž ϲ / / / Ϭ / / / // / ϯϬ Ϭ Ϭ  ϲ Ϯ Ŷ Ě   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ă Ŷ  ^ Ž Ĩ Ĩ Ă Ϭ / Ϭ / / s ϯϮ ϭ ϴ  ϲ ϯ ƌ Ě   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů D LJ  d ƌ Ƶ Ž Ŷ Ő ϰ / / Ϭ / / / s ϭϰ Ϭ ϭ  ϳ Ϯ Ŷ Ě   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ś Ă Ě  d Ğ Ɛ Ɛ ŵ Ğ ƌ ϭ / Ϭ / / / ϱϮ Ϭ ϳ   Ž Ƶ ů Ě Ğ ƌ  > Ŷ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů Z Ž Ɛ Ɛ  , Ğ ƌ ŵ Ă Ŷ ϴ / / / Ϭ / / / / s ϲϱ Ϭ ϭ   ƌ Ž Ž Ŭ ů LJ Ŷ   ƌ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ă ǁ Ŷ  D ͘   ƌ Ă LJ Ă Ϯ / Ϭ / / s ϮϬ Ϯ ϯ   ƌ Ž Ž Ŭ ǀ ŝ Ğ ǁ   ƌ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů & z Z  ^ & Z   K Z Z K t  Z  > >   ϭ / Ϭ / / // ϱϬ Ϯ ϱ   ƌ Ğ ǁ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů Z LJ Ă Ŷ  W Ă ƌ ƚ Ŷ Ğ ƌ Ɛ ͕  > >  ͬ Z LJ Ă Ŷ  ^ Đ Ś ŵ ŝĚ ƚ ϭ Ϭ / s Ϭ / s / s ϱϬ Ϯ ϱ   ƌ Ğ ǁ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů Z LJ Ă Ŷ  W Ă ƌ ƚ Ŷ Ğ ƌ Ɛ ͕  > >  ͬ Z LJ Ă Ŷ  ^ Đ Ś ŵ ŝĚ ƚ ϴ / / / Ϭ / / / / / / ϱϰ ϯ Ϯ   Ƶ Ɖ Ž Ŷ ƚ   ǀ Ğ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů y ŝ Ă Ŷ Ő ŵ ŝ Ŷ Ő  ' Ƶ Ă Ŷ Ϯ ϳ / s Ϭ / s / s ϱϰ ϱ ϱ   ŵ Ğ ƌ Ɛ Ž Ŷ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  ů ď ƌ Ƶ Ɛ  D Ă Ŷ Ă Ő Ğ ŵ Ğ Ŷ ƚ ϭ Ϭ / s Ϭ / s / s ϱϴ ϭ ϰ   ǁ ŝ Ŷ Ő   ǀ Ğ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů D ŝ Đ Ś Ğ ů Ğ  E LJ Ă ƌ Ğ Đ Ś Ă ϭ / Ϭ / / ϲϳ ϯ ϰ  & ƌ Ă Ŷ Đ Ğ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  ů Ğ dž Ă Ŷ Ě Ğ ƌ  > Ă Ŷ Ő Ϯ / Ϭ / / / ϲϵ ϭ ϵ  & ƌ Ă Ŷ Đ Ğ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ğ Ŷ ũ Ă ŵ ŝ Ŷ  , Ğ ƌ ŵ Ă Ŷ ƚ ŝ Ŷ ϯ / / Ϭ / / / s ϲϴ Ϭ Ϭ  & ƌ Ğ ŵ Ž Ŷ ƚ  W ů  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů ^ Ś Ă ƌ Ž Ŷ  D Đ ' Ă ƌ LJ ϱ / / Ϭ / / / / ϲϴ Ϯ Ϭ  & ƌ Ğ ŵ Ž Ŷ ƚ  W ů  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů ^ Ś Ă ƌ Ž Ŷ  D Đ ' Ă ƌ LJ ϯ / / / Ϭ / / / / / ϱϰ ϭ Ϭ  ' ŝ ƌ Ă ƌ Ě   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ž Ƶ Ő ů Ă Ɛ   ů ů Ğ Ŷ  t Ă Ś ů Ϯ / Ϭ / / s ϱϯ ϱ ϭ  / ƌ ǀ ŝ Ŷ Ő   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ž Ƶ Ő ů Ă Ɛ   ů ů Ğ Ŷ  t Ă Ś ů Ϯ / Ϭ / / s ϲϰ ϭ ϯ  : Ƶ Ŷ Ğ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ž Ƶ Ő ů Ă Ɛ   ů ů Ğ Ŷ  t Ă Ś ů ϰ / / Ϭ / / / s ϰϮ Ϭ ϳ  > Ă Ŭ Ğ Ɛ ŝ Ě Ğ   ǀ Ğ  η ϯ Ϯ ϳ ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů Z Ă Đ Ś Ğ ů  W Ğ ƚ nj Ϭ / Ϭ / / ϲϯ ϯ Ϭ  K ƌ Đ Ś Ă ƌ Ě   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů D Ă ƌ Ŭ  < Ž Ś ů Ɛ Ϭ / Ϭ / / / ZĞ Ŷ ƚ Ă ů  > ŝ Đ Ğ Ŷ Ɛ Ğ Ɛ  Ĩ Ž ƌ   Ž Ƶ Ŷ Đ ŝ ů   Ɖ Ɖ ƌ Ž ǀ Ă ů  Ž Ŷ   Ğ Đ Ğ ŵ ď Ğ ƌ  ϭ Ϭ ͕  Ϯ Ϭ ϭ ϴ Wƌ Ž Ɖ Ğ ƌ ƚ LJ   Ě Ě ƌ Ğ Ɛ Ɛ ǁ Ğ ů ů ŝ Ŷ Ő dLJ Ɖ Ğ ZĞ Ŷ Ğ ǁ Ă ů Žƌ  / Ŷ ŝ ƚ ŝ Ă ů Kǁ Ŷ Ğ ƌ Wƌ Ž Ɖ Ğ ƌ ƚ LJ Ž Ě Ğ sŝ Ž ů Ă ƚ ŝ Ž Ŷ Ɛ >ŝ Đ Ğ Ŷ Ɛ Ğ dLJ Ɖ Ğ WŽ ů ŝ Đ Ğ & ^  Ύ &ŝ Ŷ Ă ů  >ŝ Đ Ğ Ŷ Ɛ Ğ  dLJ Ɖ Ğ  Ύ Ύ Wƌ Ğ ǀ ŝ Ž Ƶ Ɛ  >ŝ Đ Ğ Ŷ Ɛ Ğ  dLJ Ɖ Ğ  Ύ Ύ Ύ ZĞ Ŷ ƚ Ă ů  > ŝ Đ Ğ Ŷ Ɛ Ğ Ɛ  Ĩ Ž ƌ   Ž Ƶ Ŷ Đ ŝ ů   Ɖ Ɖ ƌ Ž ǀ Ă ů  Ž Ŷ   Ğ Đ Ğ ŵ ď Ğ ƌ  ϭ Ϭ ͕  Ϯ Ϭ ϭ ϴ ϲϵ Ϭ ϴ  h Ŷ ŝ ƚ LJ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů y ŝ Ŷ Ő Ĩ Ƶ   Ś Ğ Ŷ ϳ / / / Ϭ / / / / / ϳϭ ϲ ϵ  h Ŷ ŝ ƚ LJ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů ^ Ž LJ Ğ   Ś Ă ů ƚ Ğ ϭ / Ϭ / / ϱϵ Ϯ ϱ  t Ă Ɛ Ś ď Ƶ ƌ Ŷ   ǀ Ğ  E ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ś Ğ Ŷ Ő  > Ž ƌ Ϯ / Ϭ / / / / ϰϰ ϭ ϵ  t ŝ Ŷ Đ Ś Ğ Ɛ ƚ Ğ ƌ  > Ă ^ ŝ Ŷ Ő ů Ğ  & Ă ŵ ŝ ů LJ Z Ğ Ŷ Ğ ǁ Ă ů  Ă Ɛ ƚ Ž Ŷ  , Ž ŵ Ğ Ɛ  > >  Ϯ / Ϭ / / / Ύ  & ^  с   Ă ů ů Ɛ  & Ž ƌ  ^ Ğ ƌ ǀ ŝ Đ Ğ  Ĩ Ž ƌ  Z Ğ Ŷ Ğ ǁ Ă ů  > ŝ Đ Ğ Ŷ Ɛ Ğ Ɛ  K Ŷ ů LJ  ; / Ŷ ŝ ƚ ŝ Ă ů  > ŝ ĐĞ Ŷ Ɛ Ğ Ɛ  Ă ƌ Ğ  Ŷ Ž ƚ  Ă Ɖ Ɖ ů ŝ Đ Ă ď ů Ğ  ƚ Ž  Đ Ă ů ů Ɛ  Ĩ Ž ƌ  Ɛ Ğ ƌ ǀ ŝ Đ Ğ  Ă Ŷ Ě  ǁ ŝ ů ů  ď Ğ  ů ŝ Ɛ ƚ ĞĚ  E ͬ  ͘ Ϳ ΎΎ  > ŝ Đ Ğ Ŷ Ɛ Ğ  d LJ Ɖ Ğ   Ğ ŝ Ŷ Ő  / Ɛ Ɛ Ƶ Ğ Ě d LJ Ɖ Ğ  ϭ  с  ϯ  z Ğ Ă ƌ     d LJ Ɖ Ğ  / /  с  Ϯ  z Ğ Ă ƌ      d LJ Ɖ Ğ  / / /  с  ϭ  z Ğ Ă ƌ ΎΎ Ύ  / Ŷ ŝ ƚ ŝ Ă ů  ů ŝ Đ Ğ Ŷ Ɛ Ğ Ɛ  ǁ ŝ ů ů  Ŷ Ž ƚ  Ɛ Ś Ž ǁ  Ă  Ɖ ƌ Ğ ǀ ŝ Ž Ƶ Ɛ  ů ŝ Đ Ğ Ŷ Ɛ Ğ  ƚ LJ Ɖ Ğ ů ů  Ɖ ƌ Ž Ɖ Ğ ƌ ƚ ŝ Ğ Ɛ  Ă ƌ Ğ  Đ Ƶ ƌ ƌ Ğ Ŷ ƚ  Ž Ŷ   ŝ ƚ LJ  Ƶ ƚ ŝ ů ŝ ƚ ŝ Ğ Ɛ  Ă Ŷ Ě  Ɖ ƌ Ž Ɖ Ğ ƌ ƚ LJ  ƚ Ă dž Ğ Ɛ                 ! "#   $  %& '   () &*   +   '(&', (           ((,   '(-"', (""., #'-', ",   '(- . +  /  ! #(0'((' 12-10-18 2019 City Council Meeting Schedule Regular City Council Meetings Council Chambers City Hall Study/Work Session 6:00 p.m. Informal Open Forum 6:45 p.m. Regular Session 7:00 p.m. Work Session immediately following (Continued) Regular Session Brooklyn Center City Council regularly meets the 2nd and 4th Monday each month, unless Monday is a holiday. January 14 January 28 February 11 February 25 March 11 M a r c h 2 5 A p r i l 8 A p r i l 2 2 May 13 M a y 2 8 ( T u e s d a y ) June 10 June 24 J u l y 8 July 22 August 12 August 26 September 9 September 23 October 14 O c t o b e r 2 8 November 12 (Tuesday) November 25 December 9 All dates are subject to change. Call City Hall at 763-569-3300 to verify dates and times. Strikethrough indicates meeting has been CANCELED. Special City Council Meetings All dates are Monday unless otherwise noted April 3 (Wednesday) 6:00 p.m. Joint Session w/Commissions CH April 15 7:00 p.m. Board of Appeal & Equalization CC April 29 6:00 p.m. Board of Appeal & Equalization Reconvene CC June 3 6:30 p.m. Work Session w/Auditor and Budget Work Session w/Financial Commission CC July 17 6:30 p.m. Work Session w/Financial Commission CC July 29 6:30 p.m. Work Session Work Session w/Financial Commission CC August 7 6:30 p.m. Work Session Work Session w/Financial Commission CC August 19 6:30 p.m. Work Session Work Session w/Financial Commission CC September 16 6:30 p.m. Work Session Work Session w/Financial Commission CC October 7 6:30 p.m. Work Session Work Session w/Financial Commission CC October 21 6:30 p.m. Work Session Work Session w/Financial Commission CC December 2 6:30 p.m. 2020 Budget Hearing and Special Meeting CC AA – All America Conference Room located in lower level City Hall CC – Council Chambers located in upper level City Hall CH – Constitution Hall located at Community Center CR – Council/Commission Conference Room located in lower level City Hall EBHC – Earle Brown Heritage Center, 6155 Earle Brown Drive                   !!" ## $%  &' "()")&! #'*'#&$#+!,'    #' "+*'#&                 $++!&-."! /& #')*'#&0 $#'& (""0   #' #0  12!('#(-"& "'&+ &""0')&"0& # "0&& # (##&""0))(##&2   !"0-.(+)"0$"""*/&'" (!  0"&& #.& "!! /&"0('#.&3')"" ""24&  & ' # "() &++ !& (+)"! !-.+!"0&#+! /& #')*'#&#)(".! ! /&"0('#&"#)("&*###))"&(-""0!-) # ++#&&&#2$++(("-&"('#.!#!.&+ !-."")"+"0 $(&"5#2! /& &#'"-&2  #!" & ! "'" ('# .! "'& &,! ! " ""& "'" "  &'  "( ! ((&" -&&  ! #' ) *'#& 0 $# +   #' #&"2  !()06#-+!('#&&0'&!#"&+! &+"0"#('#&! ))7! 8&"0&-#"&& ##&&!!#"!+#'#)) " )+ ''"#)('+#'"&#'& "(2! /&0('#&#)(+! -.(+)"0#&.!-' ! /&0"&2#)('"0('## '" #0 !!0".!#!. '" "#&!(#! (&+&+   "0&& #&  ! $+$# $0' ))  0 H P E H U  L Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21$'237,1*$0(1'0(176727+(),1$1&,$/32/,&,(6 6(&7,212)7+(%522./<1&(17(5&,7<&281&,/&2'(2)32/,&,(6  :+(5($6WKH&LW\&RXQFLORIWKH&LW\RI%URRNO\Q&HQWHUDGRSWHGD6FKHGXOH IRU3URIHVVLRQDO6HUYLFHV3ROLFLHVRQ2FWREHULQFOXGHGLQWKH&LW\&RXQFLO&RGHRI 3ROLFLHVDQG    :+(5($6UHYLVLRQVWR6HFWLRQ)LQDQFLDO0DQDJHPHQW3ROLFLHV6HFWLRQ& 'HEW3ROLFLHVKDYHEHHQUHYLHZHGE\WKH&LW\&RXQFLO    12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\ RI %URRNO\Q &HQWHU 0LQQHVRWD WKDW WKH DPHQGHG 6HFWLRQ  )LQDQFLDO 0DQDJHPHQW 3ROLFLHV 6HFWLRQ&'HEW3ROLFLHVDWWDFKHGKHUHWRDV([KLELWEHLQFRUSRUDWHGLQWRWKH&RGHRI3ROLFLHV DQGKHUHE\DGRSWHG     'HFHPEHU    ' D W H   0 D \ R U    $77(67        & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG   & 'HEW3ROLFLHV   7KH &LW\ ZLOO FRQILQH ORQJWHUP ERUURZLQJ WR FDSLWDO LPSURYHPHQWVRUSURMHFWVZKLFKFDQQRWEHILQDQFHGIURPFXUUHQW UHYHQXHV   :KHQWKH&LW\ILQDQFHVFDSLWDOSURMHFWVE\LVVXLQJERQGVLWZLOO SD\EDFNWKHERQGVZLWKLQDSHULRGQRWWRH[FHHGWKHH[SHFWHG XVHIXOOLIHRIWKHSURMHFW  2QDOOSURMHFWVDWOHDVWRIWKHSULQFLSDOVKDOOEHUHWLUHGZLWKLQ WHQ\HDUV7KH&LW\¶VJRDOLVWRDPRUWL]HRIRXWVWDQGLQJGHEW ZLWKLQ\HDUVKRZHYHULQQRFDVHVKDOOWKH&LW\DPRUWL]HOHVV WKDQRIRXWVWDQGLQJGHEWZLWKLQ\HDUV  6WDWH ODZ OLPLWV JHQHUDO REOLJDWLRQ GHEW WR  \HDUV LQ PRVW FLUFXPVWDQFHV7KH&LW\ZLOODWWHPSWWRNHHSWKHDYHUDJHVWDWHG PDWXULW\RI*HQHUDO2EOLJDWLRQ%RQGVDWRUEHORZ\HDUV  7RWDOGHEWVHUYLFHIRU*HQHUDO2EOLJDWLRQGHEWZLOOQRWH[FHHGILYH SHUFHQWRIWRWDODQQXDOORFDOO\JHQHUDWHGRSHUDWLQJUHYHQXHLQWKH JHQHUDOVSHFLDOUHYHQXHDQGSURSULHWDU\IXQGV   7RWDO*HQHUDO2EOLJDWLRQGHEWZLOOQRWH[FHHGWZRSHUFHQWRIWKH PDUNHWYDOXDWLRQRIWD[DEOHSURSHUW\ZLOOQRWH[FHHGWKHVWDWXWRU\ OLPLWRIRIWKHHVWLPDWHG0DUNHW9DOXHRIWD[DEOHSURSHUW\LQ WKH&LW\DVUHTXLUHGE\0LQQHVRWD6WDWXWH6HFWLRQ   :KHUHSRVVLEOHWKH&LW\ZLOOXVHVSHFLDODVVHVVPHQWUHYHQXHRU RWKHUVHOIVXSSRUWLQJERQGVLQVWHDGRI*HQHUDO2EOLJDWLRQ%RQGV UHSDLGZLWKDSURSHUW\WD[OHY\   7KH&LW\ZLOOQRWLQFXUGHEWWRVXSSRUWFXUUHQWRSHUDWLRQV   7KH &LW\ ZLOO PDLQWDLQ JRRG FRPPXQLFDWLRQV ZLWK ERQG UDWLQJ DJHQFLHVUHJDUGLQJLWVILQDQFLDOFRQGLWLRQ7KH&LW\ZLOOIROORZD SROLF\ RI IXOO GLVFORVXUH LQ HYHU\ ILQDQFLDO UHSRUW DQG ERQG SURVSHFWXV7KH&LW\VKDOOFRPSO\ZLWK6(&UXOH‹  RQ SULPDU\DQGFRQWLQXLQJGLVFORVXUH&RQWLQXLQJGLVFORVXUHUHSRUWV VKDOOEHILOHGQRODWHUWKDQGD\VDIWHUWKHHQGRIWKHILVFDO\HDU  'LUHFWQHWGHEW JURVVGHEWOHVVGHEWIXOO\VXSSRUWHGE\UHYHQXHV  SHUFDSLWDVKDOOQRWH[FHHGSHUFDSLWD7RWDOJRYHUQPHQWDO IXQGGHEWVHUYLFHFDQQRWH[FHHGRIWKH&LW\¶VJRYHUQPHQWDO IXQGH[SHQGLWXUHV   7KH&LW\ZLOOUHTXLUH0LQLPXP$VVHVVPHQW 7D[DEOH9DOXDWLRQ  $JUHHPHQWV RQ DOO SURMHFWV LQ ZKLFK WKH &LW\ LV SURYLGLQJ GHYHORSPHQW DVVLVWDQFH WKURXJK WD[ LQFUHPHQW ILQDQFLQJ RU FRPPLWWLQJLWVERQGLQJDXWKRULW\7KLVZLOOHQVXUHPLQLPDOFDVK IORZ LQFUHPHQW  WR UHSD\ REOLJDWLRQV SURYLGH DQRWKHU OHYHO RI UHYLHZ EHIRUH FRPPLWPHQW E\ WKH &LW\ $VVHVVRU  DQG WR WKH PLQLPDO YDOXH DJUHHG XSRQ HOLPLQDWH WD[ DSSHDOV GXULQJ WKH DJUHHPHQWSHULRG  7KH&LW\VKDOOXVHYDULDEOHUDWHGHEWRQO\LIWRWDOSULQFLSDODQG LQWHUHVWRIWKHGHEWFRQVWLWXWHVOHVVWKDQRIWKH&LW\¶VWRWDO GHEW SD\PHQWV DQG RQO\ LI FLUFXPVWDQFHV GLFWDWH WKH QHHG IRU D VKRUWWHUPFDOOGDWH7KH&LW\ZLOOQRWXVHGHULYDWLYHEDVHGGHEW  7KH &LW\ VKDOO XVH DQ RXWVLGH ERQG DWWRUQH\ DQ LQGHSHQGHQW PXQLFLSDODGYLVRUWRVWUXFWXUHWKHVDOHRIGHEWDQGDSD\LQJDJHQW IRUERRNHQWU\WUDQVDFWLRQV  7KH&LW\VKDOOLQYHVWERQGSURFHHGVLQDVHSDUDWHDFFRXQWLQRUGHU WRDFFRXQWIRUHDUQLQJVRQLQYHVWHGSURFHHGVIRUWKHSXUSRVHVRI FRPSO\LQJZLWKDUELWUDJHUHJXODWLRQV7KH&LW\VKDOOFRPSOHWHDQG DUELWUDJHUHEDWHUHSRUWIRUHDFKLVVXHQROHVVWKDQHYHU\ILYH\HDUV DIWHULWVGDWHRILVVXDQFH                     !!" ## $%  &' #$((#'&&( )*'(  &+,' $-#'+  "                      #",&" )*&(((! (*' !&"&# &&"!--- #'&&(#(! )*'(  &&'&&-&&-&( ""  ) ",&--( ./  ! 0& "'#" '&&(#1'#2   #' "(1'#&$#/34"(& -&( "&&-,&-+"")! 5!#!!5+ &(-&" #-',#/! )*( "!&#+"' "&(&"#&!'"(, 6 ! ! 7'8736 (+(86776 -/!+-+ (!( " +!-"5&89 /:')'+! )*'(  &&# (,5'') )'"; + &)&'(<& ((#/  :)'+!---&(!&#+&&+,'$-#'+ ( "5!#! &" ## ("-!-#"&(&-#(#+ & #&!&#"#,," =-" (&-#("- -&&!!")&+##-'->#&/  : 5'' #   ) " ( !& ( " ! &, & 5 !+  ! -& !& ' #!& ! ( "& #'&&(#"-&/  ! $($# $)' ,,  0 H P E H U  L Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21 ',5(&7,1* 67$)) 72 5(&/$66,)< &(17(5%522. *2/)&2856(72$*29(510(17$/63(&,$/5(9(18()81'  :+(5($6&HQWHUEURRN*ROI&RXUVHLVFXUUHQWO\DQG(QWHUSULVHIXQGDQG  :+(5($67KH&LW\¶V)LQDQFLDO3ROLFLHVGLFWDWHWKDW(QWHUSULVHIXQGVFKDUJH VXIILFLHQWXVHUIHHVWRIXQGRSHUDWLRQVDQGFDSLWDOPDLQWHQDQFHDQG  :+(5($6&DVKVXEVLGLHVIURPWKH&LW\¶V*HQHUDOIXQGDYHUDJLQJSHU \HDUIURPWRKDYHEHHQUHTXLUHGWRPDLQWDLQSRVLWLYHFDVKEDODQFHLQWKH&HQWHUEURRN *ROI&RXUVHIXQGDQG  :+(5($6&HQWHUEURRN*ROI&RXUVHZRXOGEHPRUHDSSURSULDWHO\UHSRUWHGDVD 6SHFLDO5HYHQXHIXQG    12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\ RI %URRNO\Q&HQWHU0LQQHVRWDWKDWWKH&HQWHUEURRN*ROI&RXUVHIXQGLVQRZD6SHFLDO5HYHQXH )XQGDQGJLYHVVWDIIGLUHFWLRQWRSURFHHGZLWKWKHUHFODVVLILFDWLRQ     1RYHPEHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG                    !!" ## $%  &'  (!)*+ ""(#,-! ,.'+  & "" /'*)/()& "                             *000! /'*)/()& ""(#"1 2  ! ,.'+  &+ "/ +)/()&!# &3 ,.-&/!"(#&'')&+12  /3 ,.)"/)&'1242,- " 5, !&!"(','#&!). /)!/&&3   !&)!'+ "!&, ).& ,&"/)&)/&(#&!,'#! ,.'+  &+ "3!&&+&'"1640 (!/"-!""'104  & /&+ ",-3  $++&#))"!&"(#,+(&& '.'! ,.'+  &-'',,' & ++#& #& &"+'+ "& ,&"&/! /'*)/()&+ "3  !&//&"+(&&-'' ') ! + " ,'# +1407 ,-! ,. '+  &+ "" /'*)/()&+ "3   ! $+$# $,' ))  0 H P E H U  L Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21 72 )25*,9( %$/$1&( 2) ,17(5)81' $'9$1&( 0$'( ,1  )520 &$3,7$/ ,03529(0(176 )81' 72 &(17(5%522.*2/)&2856(  :+(5($6LQWKH&DSLWDO,PSURYHPHQWV)XQGDGYDQFHGWRWKH &HQWHUEURRN*ROI&RXUVHIXQGIRUFRXUVHLPSURYHPHQWVWREHUHSDLGRYHU\HDUVDWLQWHUHVW  DQG  :+(5($6  WKH &HQWHUEURRN *ROI &RXUVH KDV EHHQ XQDEOH WR PDNH DQ\ SD\PHQWVRQWKHDGYDQFHGXHWRGHILFLWFDVKEDODQFHVGDWLQJEDFNWRDQG  :+(5($6WKH\HDUHQGDXGLWHGEDODQFHRIWKHDGYDQFHZDVDQG  :+(5($6LWLVQRORQJHUH[SHFWHGWKDWWKH&HQWHUEURRN*ROI&RXUVHZLOOEH DEOHWRJHQHUDWHVXIILFLHQWIXQGVWRUHSD\WKHDGYDQFH    12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\ RI %URRNO\Q&HQWHU0LQQHVRWDWKDWWKHLQWHUIXQGDGYDQFHIURPWKH&DSLWDO,PSURYHPHQWV)XQGWR WKH&HQWHUEURRN*ROI&RXUVHIXQGEHIRUJLYHQ     1RYHPEHUHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG                  !"#$%" &  "'!#  !"!%( )*% (+  %! ))* ' ,-."")#$/0,, '1 &!02"-. 3456/(-.' !,#7!! 80)*0%                    !"!#$%!& '(  )     ' 3 )!80)*009 8:,/,'' !/6/(-."! , /! %'%%07;*!*%"'"$*!*%,, //!7!!),!""!"!%.8 ,,7'')2"7% ,'7/ !%'"! ,,',// ,%/) 0)%, ,) 0)). -*0 < 3'   "!7,,""%"'"! (! %8"./#$-/' % ,)! %!%,5/=<>>?@. %"'"!(! %8".'%% ""%%/ !!"0)!,'7$,%A %/!)0/ ')2".'7%"',')2"/=5 /"%/'0" )%% ) 0)% ",%"'))%,,,!77!!"!,,%)%!/"!!",, %.  '!""0 7'%"'"!(! %8"./'6/(-. ' !,#7!!80)*0%7%=<>>?@.'!*! /7$"/,//!)0 "! , ' ,-.%=55<@.'!)2""%"! , ""%,0%!!%=5 <>5. 5,7%"0)!,.<)" , , '0 /=53.@.'"',%! )*,%% 00/'/!0,,"%%,/ , % "%/')2".  ! '", 00 80 0 H P E H U  L Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21$33529,1*&+$1*(25'(512$&&(37,1*:25. 3(5)250(' $1' $87+25,=,1* ),1$/ 3$<0(17 352-(&7 12  /,)7 67$7,21 12  5(+$%,/,7$7,21 $1' :(7:(// ,03529(0(176  :+(5($6 SXUVXDQW WR ZULWWHQ FRQWUDFWV VLJQHG ZLWK WKH &LW\ RI%URRNO\Q &HQWHU 0LQQHVRWD 0LQQHVRWD 0HFKDQLFDO &RQWUDFWRUV ,QF RI :DLWH 3DUN 0LQQHVRWD KDV FRPSOHWHGWKHIROORZLQJLPSURYHPHQWVLQDFFRUGDQFHZLWKVDLGFRQWUDFW  3URMHFW1R/LIW6WDWLRQ1R5HKDELOLWDWLRQDQG:HWZHOO,PSURYHPHQWV  :+(5($60LQQHVRWD0HFKDQLFDO&RQWUDFWRUV,QFZHUHLQVWUXFWHGWRFRPSOHWH DGGLWLRQDOZRUNQRWLQFOXGHGLQWKHRULJLQDO&RQWUDFWEXWZDVGHHPHG QHFHVVDU\WRSURSHUO\ FRPSOHWH WKH LPSURYHPHQWV LQFOXGLQJ DQ LQFUHDVH RI WKH HPHUJHQF\ E\SDVV SXPS VXFWLRQ GLVFKDUJHSLSHVDQGDGGLWLRQDOZHWZHOOFOHDQLQJDQGGLVSRVDORIFROOHFWHGGHEULVDVLGHQWLILHGRQ &KDQJH2UGHU1R  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHU0LQQHVRWDWKDW   &KDQJH2UGHU1RLQWKHDPRXQWRIIRU,PSURYHPHQW1R LVKHUHE\DSSURYHG   )LQDOSD\PHQWVKDOOEHPDGHRQ3URMHFW1R/LIW6WDWLRQ1R 5HKDELOLWDWLRQDQG:HWZHOO,PSURYHPHQWVWDNLQJWKHFRQWUDFWRU¶VUHFHLSW LQ IXOO 7KH WRWDO DPRXQW WREHSDLG IRU VDLG LPSURYHPHQWV XQGHU VDLG FRQWUDFWVVKDOOEH   7KHHVWLPDWHGSURMHFWFRVWVDUHKHUHE\DPHQGHGDVIROORZV  &2676    $V2ULJLQDO$ZDUG $V)LQDO &RQVWUXFWLRQ&RQWUDFW   &KDQJH2UGHU1R     (QJLQHHULQJDQG$GPLQLVWUDWLYH    &RQWLQJHQF\   727$/       5(9(18(6   $V2ULJLQDO$ZDUG $V)LQDO  6DQLWDU\6HZHU8WLOLW\     5(62/87,2112BBBBBBBBBBBBBBB        'HFHPEHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG                   !"# $ %  "" &&&'()$!"# *#$"& *+  &" ##!) $)*!$&,-. )" ' .#" & )  !"#&). # &&&/                                !   . # &&&/ #',.#" & )  !"#& 0 1#!'&'$22$.$"&&&$&!$&"$"# &'& "" , &&&&3.&!$&$" ', &&&'&$#"'!"#  '$ $& #")$"&&&& ')"&#$&&"&!$&3 # &&&'!&&"&&&& # &'),-'&'$$&&)$#&.,& . 4 '&3  . # &&&/ $ "#&-.5$ &'6$&-..- & #"3. # &&&# .&,#!'&!$&" &$  3 # &&&'!&&#!', &&&'"'$& "&,2 .",&& "  ""3## &#)', -"2&-"$  # 3  % + . .7! ,   # &&&'!&&&&&'# &" '#!''##8 "9:. &)'$$.$"&&&$32'#.& ).  # &&&# )" -"",#!''.   $""%,  63  .$ $$,-. )" ' ). # &&&# 8#&.')  3.##&'-$$-"".!;2  . ..')  -. "$&)<  3. )" .& "$&)<= ).# '. <= &$!',.#   &'!"#  .3  . "<= $&). # &&&# -"",) '',.$ $!"#   .)" >&#)&&"&!$&$$ 3  ! &'$ $*," Member introduced the following resolution and moved its adoption: RESOLUTION NO. RESOLUTION APPROVING A CONTRACT FOR SERVICES BETWEEN THE CITY OF BROOKLYN CENTER AND METROPOLITAN CONSORTIUM OF COMMUNITY DEVELOPERS FOR THE OPEN TO BUSINESS PROGRAM WHEREAS, the City Council of Brooklyn Center, Minnesota (the “City”) has received a contract for services from Metropolitan Consortium of Community Developers company (the “MCCD”) for the Open to Business program which provides technical business and lending assistance to existing businesses, residents, and parties interested in starting a business in Brooklyn Center; and WHERES, the current contract for services with MCCD for the Brooklyn Center Open to Business program expires on December 31, 2018; and WHERES, the approved contract for services with MCCD for the Brooklyn Center Open to Business program will have a three-year term and will expire on December 31, 2021; and WHEREAS, the contract for services includes an annual cost to the City of $5,000 to be paid through the Economic Development Authority of Brooklyn Center’s Professional Services account; and WHERES, the MCCD agrees to submit reports related to the Brooklyn Center Open to Business program twice per year and additional reports as requested by the City; and NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Brooklyn Center, Minnesota, that it hereby approves the contract for services between the City of Brooklyn Center and the Metropolitan Consortium of Community Developers for the Open to Business Program. December 10, 2018 Date Mayor ATTEST: City Clerk The motion for the adoption of the foregoing resolution was duly seconded by member and upon vote being taken thereon, the following voted in favor thereof: and the following voted against the same: whereupon said resolution was declared duly passed and adopted.  &RQWUDFWIRU6HUYLFHV %HWZHHQWKH&LW\RI%URRNO\Q&HQWHU  0HWURSROLWDQ&RQVRUWLXPRI&RPPXQLW\'HYHORSHUV IRUWKH 2SHQWR%XVLQHVV3URJUDP   7+,6$*5((0(17LVPDGHDQGHQWHUHGLQWRDVRIWKHVWGD\RI-DQXDU\EHWZHHQWKH &LW\RI%URRNO\Q&HQWHUDQG0HWURSROLWDQ&RQVRUWLXPRI&RPPXQLW\'HYHORSHUV KHUHLQ FDOOHG³0&&'´   :+(5($6WKH&LW\RI%URRNO\Q&HQWHUZLVKHVWRUHWDLQDQHQWLW\ZLWKWKHFDSDFLW\WRSURYLGH VPDOOEXVLQHVVWHFKQLFDODVVLVWDQFHWRH[LVWLQJEXVLQHVVHVDQGWKRVHSDUWLHVLQWHUHVWHGLQRSHQLQJ DEXVLQHVVLQ%URRNO\Q&HQWHU WKH³,QLWLDWLYH´ DQG  :+(5($60&&'KDVUHSUHVHQWHGLWVHOIDVFRPSHWHQWWRSURYLGHWKHVHUYLFHVUHTXLUHGWR DGPLQLVWHUDQGFDUU\RXWWKH,QLWLDWLYHDQG  :+(5($6WKH&LW\RI%URRNO\Q&HQWHUZLVKHVWRHQJDJH0&&'WRSURYLGHVDLGVHUYLFHV QHFHVVDU\WRFDUU\RXWWKH,QLWLDWLYH  12:7+(5()25(LWLVDJUHHGEHWZHHQWKHSDUWLHVKHUHWRWKDW    7,0(2)3(5)250$1&(  7KHVHUYLFHWREHSURYLGHGE\0&&'VKDOOFRPPHQFHRQ-DQXDU\DQGXQOHVV FDQFHOHGE\HLWKHUSDUW\DXWRPDWLFDOO\UHQHZ-DQXDU\DQG-DQXDU\ (LWKHUSDUW\PD\DWWKHLUVROHGLVFUHWLRQDQGZLWKRXWFDXVHFDQFHODQ\UHPDLQLQJ\HDUV FRYHUHGXQGHUWKLVDJUHHPHQWE\SURYLGLQJZULWWHQQRWLFHWRWKHRWKHUSDUW\DWOHDVW GD\VSULRUWRUHQHZDO(DFK3DUW\DJUHHVWKDWD3DUW\WKDWRSWVRXWRIWKHFRQWUDFWXQGHU WKHVHWHUPVVKDOOEHVXEMHFWWRQRSHQDOW\DQGKHOGKDUPOHVVIRUIXWXUHOLDELOLW\RU REOLJDWLRQUHODWHGWRWKHWHUPVRIWKLVDJUHHPHQW$OOVHUYLFHVGRFXPHQWVDQG LQIRUPDWLRQWREHIXUQLVKHGRUSHUIRUPHGE\0&&'LQRUGHUWRFDUU\RXWWKH,QLWLDWLYH VKDOOEHIXUQLVKHGRUSHUIRUPHGDVSURPSWO\DVSRVVLEOHDQGZLWKWKHIXOOHVWGXH GLOLJHQFH   &203(16$7,21 7RWDOFRPSHQVDWLRQWR0&&'VKDOOEHIRUDRQH\HDUSHULRG WKH&RQWUDFW $PRXQW WRPDQDJHWKH%URRNO\Q&HQWHU2SHQWR%XVLQHVVSURJUDP7KH&RQWUDFW $PRXQWZLOOEHSDLGLQWZRHTXDOLQVWDOOPHQWVGXHDQGSD\DEOHE\WKH&LW\RI %URRNO\Q&HQWHUXSRQH[HFXWLRQRIWKLV$JUHHPHQWDQGLQYRLFHGDQGGDWHGRQRU DERXWPRQWKVIURPWKHDJUHHPHQWGDWHSD\DEOHE\+HQQHSLQ&RXQW\+RXVLQJ 5HGHYHORSPHQW$XWKRULW\    6&23(2)6(59,&(6 0&&'ZLOOXVHWKH&RQWUDFW$PRXQWWRSURYLGHWHFKQLFDODVVLVWDQFHWRH[LVWLQJ%URRNO\Q &HQWHUEXVLQHVVHVUHVLGHQWVDQGSDUWLHVLQWHUHVWHGLQVWDUWLQJDEXVLQHVVLQ%URRNO\Q &HQWHU 6HH([KLELW$6FRSHRI6HUYLFHV%URRNO\Q&HQWHU2SHQWR%XVLQHVV3URJUDP    5(3257,1* 0&&'DJUHHVWRVXEPLWUHSRUWVUHODWHGWRLWVRSHUDWLRQRIWKH%URRNO\Q&HQWHU2SHQWR %XVLQHVVSURJUDP,WHPVWREHUHSRUWHGRQLQFOXGHEXWDUHQRWOLPLWHGWRWKHIROORZLQJ  ¾1XPEHURILQTXLULHV  ¾+RXUVRIWHFKQLFDODVVLVWDQFHSURYLGHG  ¾7\SHRIDVVLVWDQFHSURYLGHG  ¾7\SHRIEXVLQHVV  ¾$QQXDOVDOHVUHYHQXH  ¾1XPEHURIEXVLQHVVHVRSHQHG  ¾1XPEHURIEXVLQHVVH[SDQGHGVWDELOL]HG  ¾1XPEHUDQGDPRXQWVRIILQDQFLQJSDFNDJHV  ¾'HPRJUDSKLFLQIRUPDWLRQRQHQWUHSUHQHXUV  7KHUHTXLUHGUHSRUWLQJVFKHGXOHLVDVIROORZV  -DQXDU\±-XQHDFWLYLW\UHSRUWGXH-XO\VW  -DQXDU\±'HFHPEHUDFWLYLW\UHSRUWGXH-DQXDU\VW  0&&'ZLOOSURYLGHDGGLWLRQDOUHSRUWVDVUHTXHVWHGE\WKH&LW\RI%URRNO\Q&HQWHU   3(56211(/ 0&&'UHSUHVHQWVWKDWLWKDVRUZLOOVHFXUHDWLWVRZQH[SHQVHDOOSHUVRQQHOUHTXLUHGLQ SHUIRUPLQJWKHVHUYLFHVWRFDUU\RXWWKH,QLWLDWLYH6XFKSHUVRQQHOVKDOOQRWEHHPSOR\HHV RIRUKDYHDQ\FRQWUDFWXDOUHODWLRQVKLSZLWKWKH&LW\RI%URRNO\Q&HQWHU1RWHQXUHRU DQ\RWKHUULJKWVRUEHQHILWVLQFOXGLQJZRUNHU¶VFRPSHQVDWLRQXQHPSOR\PHQWLQVXUDQFH PHGLFDOFDUHVLFNOHDYHYDFDWLRQSD\VHYHUDQFHSD\RUDQ\RWKHUEHQHILWVDYDLODEOHWR &LW\RI%URRNO\Q&HQWHUHPSOR\HHVVKDOODFFUXHWR0&&'RUHPSOR\HHVRI0&&' SHUIRUPLQJVHUYLFHVXQGHUWKLVDJUHHPHQW7KH0&&'LVDQLQGHSHQGHQWFRQWUDFWRU   $OORIWKHVHUYLFHVUHTXLUHGWRFDUU\RXWWKH,QLWLDWLYHZLOOEHSHUIRUPHGE\0&&'DQG DOOSHUVRQQHOHQJDJHGLQWKHZRUNVKDOOEHIXOO\TXDOLILHGDQGVKDOOEHDXWKRUL]HGRU SHUPLWWHGXQGHU6WDWHDQGORFDOODZWRSHUIRUPVXFKZRUN   ,17(5(672)0(0%(562)7+(&,7<('$$1'27+(56  1RRIILFHUPHPEHURUHPSOR\HHRIWKH&LW\RI%URRNO\Q&HQWHUDQGQRPHPEHURILWV JRYHUQLQJERG\DQGQRRWKHUSXEOLFRIILFLDORUJRYHUQLQJERG\RIWKHORFDOLW\LQZKLFK WKH,QLWLDWLYHLVVLWXDWHGRUEHLQJFDUULHGRXWZKRH[HUFLVHVDQ\IXQFWLRQVRU UHVSRQVLELOLWLHVLQWKHUHYLHZRUDSSURYDORIWKHXQGHUWDNLQJRUFDUU\LQJRXWRIWKH ,QLWLDWLYHVKDOOSDUWLFLSDWHLQWKHGHFLVLRQUHODWLQJWRWKLV$JUHHPHQWZKLFKDIIHFWVKLVKHU SHUVRQDOLQWHUHVWRUWKHLQWHUHVWRIDQ\FRUSRUDWLRQSDUWQHUVKLSRUDVVRFLDWLRQLQZKLFK KHVKHLVGLUHFWO\RULQGLUHFWO\LQWHUHVWHGRUKDVDQ\SHUVRQDORUSHFXQLDU\LQWHUHVWGLUHFW RULQGLUHFWLQWKLV$JUHHPHQWRUSURFHHGVWKHUHRI   $66,*1$%,/7<  0&&'VKDOOQRWDVVLJQDQ\LQWHUHVWLQWKLV$JUHHPHQWDQGVKDOOQRWWUDQVIHUDQ\LQWHUHVW LQWKHVDPHZLWKRXWWKHSULRUZULWWHQDSSURYDORIWKH&LW\RI%URRNO\Q&HQWHUWKHUHWR   &203/,$1&(:,7+/2&$//$:6  0&&'DJUHHVWRFRPSO\ZLWKDOOIHGHUDODQGVWDWHODZVVWDWXWHVDQGDSSOLFDEOH UHJXODWLRQVDQGWKHRUGLQDQFHVRIWKH&LW\RI%URRNO\Q&HQWHU   ,1685$1&( 0&&'DJUHHVWRSURYLGHSURRIRIZRUNHUV¶FRPSHQVDWLRQDQGFRPSUHKHQVLYHJHQHUDO OLDELOLW\LQVXUDQFH&RPSUHKHQVLYHJHQHUDOOLDELOLW\LQVXUDQFHVKDOOEHLQWKHPLQLPXP DPRXQWRI   +2/'+$50/(66  0&&'DJUHHVWRGHIHQGSURWHFWLQGHPQLI\DQGKROGKDUPOHVVWKH&LW\RI%URRNO\Q &HQWHUWKHLUDJHQWVRIILFHUVDQGHPSOR\HHVKDUPOHVVIURPDQGDJDLQVWDOOOLDELOLWLHV ORVVHVGDPDJHVFRVWVDQGH[SHQVHVZKHWKHUSHUVRQDOSURSHUW \RUFRQWUDFWXDO LQFOXGLQJUHDVRQDEOHDWWRUQH\¶VIHHVDULVLQJRXWRIRUUHODWHGWRWKHDGPLQLVWUDWLRQDQG RSHUDWLRQRIWKH,QLWLDWLYHDQGIURPDQ\DFWRIQHJOLJHQFHRI0&&'LWVRIILFHUV HPSOR\HHVVHUYDQWVDJHQWVRUFRQWUDFWRUV   7KH&LW\RI%URRNO\Q&HQWHUDJUHHWRGHIHQGSURWHFWLQGHPQLI\DQGKROGKDUPOHVVWKH 0&&'LWVDJHQWVRIILFHUVDQGHPSOR\HHVKDUPOHVVIURPDQGDJDLQVWDOOOLDELOLWLHV ORVVHVGDPDJHVFRVWVDQGH[SHQVHVZKHWKHUSHUVRQDOSURSHUW \RUFRQWUDFWXDO LQFOXGLQJUHDVRQDEOHDWWRUQH\¶VIHHVDULVLQJRXWRIRUUHODWHGWRWKHDGPLQLVWUDWLRQDQG RSHUDWLRQRIWKH,QLWLDWLYHDQGIURPDQ\DFWRIQHJOLJHQFHRIWKH&LW\RI%URRNO\Q&HQWHU WKHLURIILFHUVHPSOR\HHVVHUYDQWVDJHQWVRUFRQWUDFWRUV   127,&(6  $QRWLFHGHPDQGRURWKHUFRPPXQLFDWLRQXQGHUWKH$JUHHPHQWE\HLWKHUSDUW\WRWKH RWKHUVKDOOEHVXIILFLHQWO\JLYHQRUGHOLYHUHGLILWLVGLVSDWFKHGE\PDLOSRVWDJHSUHSDLG UHWXUQUHFHLSWUHTXHVWHGRUGHOLYHUHGSHUVRQDOO\DQG   D ,QWKHFDVHRI0&&'LVDGGUHVVHGRUGHOLYHUHGSHUVRQDOO\WR  /HH+DOO&KLHI2SHUDWLQJ2IILFHU 0HWURSROLWDQ&RQVRUWLXPRI&RPPXQLW\'HYHORSHUV &KLFDJR$YHQXH6RXWK 0LQQHDSROLV01   E ,QWKHFDVHRIWKH&LW\RI%URRNO\Q&HQWHU  0HJ%HHNPDQ %XVLQHVVDQG'HYHORSPHQW'LUHFWRU &LW\RI%URRNO\Q&HQWHU 6KLQJOH&UHHN3NZ\ %URRNO\Q&HQWHU01  RUDWVXFKRWKHUDGGUHVVZLWKUHVSHFWWRDQ\SDUW\DVWKDWSDUW\PD\GHVLJQDWHLQZULWLQJ DQGIRUZDUGWRWKHRWKHUDVSURYLGHLQWKH6HFWLRQ   02',),&$7,21  7KLV$JUHHPHQWPD\QRWEHPRGLILHGFKDQJHGRUDPHQGHGLQDQ\PDQQHUZKDWVRHYHU ZLWKRXWWKHSULRUZULWWHQDSSURYDORIDOOWKHSDUWLHVKHUHWR  ,1:,71(66:+(5(2)WKHSDUWLHVKHUHWRKDYHH[HFXWHGWKLV$JUHHPHQWRQWKHGD\ DQG\HDUILUVWZULWWHQDERYH   &,7<2)%522./<1&(17(5 0(75232/,7$1&216257,80 2)&20081,7<'(9(/23(56   % \   % \    7 L P  : L O O V R Q   0 D \ R U  - L P  5 R W K   , W V  ( [ H F X W L Y H  ' L U H F W R U   $QGE\  %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  &XUW%RJDQH\&LW\0DQDJHU      ([KLELW$ 6FRSHRI6HUYLFHV     2SHQIRU%XVLQHVV7HFKQLFDO$VVLVWDQFH6HUYLFHV 0&&'ZLOOSURYLGHLQWHQVLYHRQHRQRQHWHFKQLFDODVVLVWDQFHWR%URRNO\Q&HQWHUEXVLQHVVHV %URRNO\Q&HQWHUUHVLGHQWVDQGDVSLULQJHQWUHSUHQHXUVLQWHQGLQJWRHVWDEOLVKSXUFKDVHRU LPSURYHDEXVLQHVVLQ%URRNO\Q&HQWHU7HFKQLFDODVVLVWDQFHLQFOXGHVEXWLVQRWOLPLWHGWRWKH IROORZLQJ  ¾%XVLQHVVSODQGHYHORSPHQW  ¾)HDVLELOLW\DQDO\VLV  ¾0DUNHWLQJ  ¾&DVKIORZDQGRWKHUILQDQFLDOSURMHFWLRQGHYHORSPHQW  ¾2SHUDWLRQDODQDO\VLV  ¾&LW\DQG6WDWHOLFHQVLQJDQGUHJXODWRU\DVVLVWDQFH  ¾/RDQSDFNDJLQJDQGRWKHUDVVLVWDQFHLQREWDLQLQJILQDQFLQJ  ¾+HOSLQREWDLQLQJFRPSHWHQWOHJDODGYLFH  0&&'ZLOODOVRSURYLGHWHFKQLFDODVVLVWDQFHRQDZDONLQEDVLVPRQWKO\LQ%URRNO\Q&HQWHU &LW\+DOORUDVUHTXHVWHGDWDSODFHRIEXVLQHVVZLWKLQ%URRNO\Q&HQWHU   2SHQWR%XVLQHVV$FFHVVWR&DSLWDO $FFHVVWRFDSLWDOZLOOEHSURYLGHGWRTXDOLI\LQJEXVLQHVVHVWKURXJK0&&'¶V(PHUJLQJ6PDOO %XVLQHVV/RDQ3URJUDP VHH([KLELW%6PDOO%XVLQHVV/RDQ3URJUDP*XLGHOLQHVEHORZ  0&&'DOVRSURYLGHVLWVILQDQFLQJLQSDUWQHUVKLSRWKHUFRPPXQLW\OHQGHUVEDQNVRUERWK   (;+,%,7%  6PDOO%XVLQHVV/RDQ3URJUDP*XLGHOLQHV  /RDQ$PRXQWV x8SWRIRUVWDUWXSEXVLQHVVHV x/DUJHUILQDQFLQJSDFNDJHVIRUHVWDEOLVKHGEXVLQHVVHV x'HVLJQHGWROHYHUDJHRWKHUILQDQFLQJSURJUDPVDVZHOODVSULYDWHILQDQFLQJSURYLGHGE\ WKHFRPPHUFLDOEDQNLQJFRPPXQLW\ (OLJLEOH3URMHFWV x%RUURZHUVPXVWEHD³IRUSURILW´EXVLQHVV x%XVLQHVVPXVWEHFRPSOLPHQWDU\WRH[LVWLQJEXVLQHVVFRPPXQLW\ x%RUURZHUVPXVWKDYHHTXLW\LQMHFWLRQDVGHWHUPLQHGE\IXQGPDQDJHPHQW $OORZDEOH8VHRI3URFHHGV x/RDQSURFHHGVFDQEHXVHGIRUZRUNLQJFDSLWDOLQYHQWRU\EXLOGLQJDQGHTXLSPHQWDQG JHQHUDOEXVLQHVVRSHUDWLRQV ,QWHUHVW5DWHV x/RDQLQWHUHVWUDWHLVGHSHQGHQWRQXVHWHUPDQGRWKHUIDFWRUVQRWWRH[FHHG /RDQ7HUP/HQJWK x/RDQUHSD\PHQWWHUPVZLOOJHQHUDOO\UDQJHIURPWKUHHWRILYH\HDUVEXWPD\EH VXEVWDQWLDOO\ORQJHUIRUPDMRUDVVHWILQDQFLQJVXFKDVFRPPHUFLDOSURSHUW\ )HHVDQG&KDUJHV x%RUURZHUVDUHUHVSRQVLEOHIRUSD\LQJDOOFXVWRPDU\OHJDODQGRWKHUORDQFORVLQJFRVWV                    !"#$%" &  $! %  '(  %! "")#$*+,, -.&!+/"01 23 4 5$'* %'"-!!,',6!$7+)5+%                    !" #$   % & ' & ( & )     ')+ 4 2-   "!6,,/"01 23 4 "7,7"1*!+ - %*-"% "*-5$'* %'"-!!,',6!$ 7+)5+%1 "7,7"1-%% ""%%* !!"+)!,-"% "6$*-)/"1  -!""+ 6- "7,7"1*)/"+)5+%6%89:9 1: 1-! 5! *6$"*,**!)+%8 ;41 1-!)/""%"! , ""%,+%!!%8<9 9912;,6%"+)!,:14)" , , -+ *8 9 141-"-,%! )5,%% ++*-*!+,,"%%,* , % "%*-)/"1  ! =%)75%+% 0 H P E H U  L Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21 $&&(37,1* :25. 3(5)250(' $1' $87+25,=,1* ),1$/ 3$<0(17 352-(&7 12  (9(5*5((1 3$5. $5($ 6$)(5287(6726&+22/75$,/$1'6,'(:$/.,03529(0(176  :+(5($6 SXUVXDQWWRDZULWWHQFRQWUDFWVLJQHGZLWKWKH&LW\RI%URRNO\Q &HQWHU 0LQQHVRWD &RQFUHWH ,GHD,QF RI 3O\PRXWK0LQQHVRWD KDVFRPSOHWHGWKHIROORZLQJ LPSURYHPHQWVLQDFFRUGDQFHZLWKVDLGFRQWUDFW  ,PSURYHPHQW3URMHFW1R(YHUJUHHQ3DUN$UHD6DIH5RXWHVWR6FKRRO 7UDLODQG6LGHZDON,PSURYHPHQWV  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHU0LQQHVRWDWKDW   )LQDO SD\PHQW VKDOO EH PDGH RQ ,PSURYHPHQW 3URMHFW 1R  (YHUJUHHQ 3DUN $UHD 6DIH 5RXWHV WR 6FKRRO 7UDLO DQG 6LGHZDON ,PSURYHPHQWVWDNLQJWKHFRQWUDFWRU¶VUHFHLSWLQIXOO7KHWRWDODPRXQWWR EHSDLGIRUVDLGLPSURYHPHQWVXQGHUVDLGFRQWUDFWVKDOOEH   7KHHVWLPDWHGSURMHFWFRVWVDQGUHYHQXHVDUHKHUHE\DPHQGHGDVIROORZV  &2676    $V2ULJLQDO$ZDUG $V)LQDO &RQWUDFW        &RQWLQJHQF\        $GPLQ/HJDO(QJ WRGDWH      (QJLQHHULQJ (VWLPDWHIRU'HF      7RWDO(VWLPDWHG3URMHFW&RVW      5(9(18(6     $V2ULJLQDO$ZDUG$V)LQDO 6WUHHW5HFRQVWUXFWLRQ)XQG     &DSLWDO3URMHFWV)XQG      )HGHUDO*UDQW        0LVFHOODQHRXV        7RWDO(VWLPDWHG5HYHQXH             5(62/87,2112BBBBBBBBBBBBBBB     'HFHPEHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG B R Y A N T A V E N 7 2 N D A V E N C O L F A X A V E N £¤25 2 D U P O N T A V E N H U M B O L D T A V E N B R O O K L Y N P A R K B R O O K L Y N C E N T E R G I R A R D A V E N 69 T H A V E N AM Y L N F R E M O N T A V E N WO O D B I N E L N 7 0 T H A V E N E M E R S O N A V E 68 T H L N N EM E R S O N L N ALDR I C H C T 73 R D A V E N 72 N D A V E N I R V I N G A V E N C A M D E N A V E N J A M E S A V E N 70 T H A V E N B R Y A N T A V E N WO O D B I N E L N E M E R S O N A V E N 71 S T A V E N 72 N D A V E N 72 N D A V E N Si d e w a l k a n d T r a i l I m p r o v e m e n t s Ev e r g r e e n P a r k A r e a 6D I H  5 R X W H V  7 R  6 F K R R O Ü /R F D W L R Q  0 D S Le g e n d Re p l a c e E x i s t i n g Tr a i l Pr o p o s e d N e w 8 ' Tr a i l Re p l a c e E x i s t i n g Si d e w a l k Pr o p o s e d N e w 6 ' Si d e w a l k Ex i s t i n g S i d e w a l k or T r a i l t o R e m a i n Pr o j e c t B o u n d a r y                 ! "#   $  %&&'() *" ("( +,  "& ++&"- & . /                  +( 0-1  12 "11   (&"1&&-31"&-&&*#&"-1  &&"#)1 *#&"1 --""-*#&" 4  (*  *#&"(*#""15"*6-# 7&(!)" #&( #**#&"+&" !"-1"*#&""7&"1 1 11(&&(57#("" (""& !1&&  #"- /  1(7- &"1!" "&"-11418 9:4 - &&4**#&"  -&-9- &&**#&"!)-1 1"4!&&*#&"15(( & #1("-1   (&1 1#&("" "7&!)( ""&" !" 1(*#51*)#&(  1 ##"  7  #5 " -  1 #( & ! ("  ; &" #5 " - "(1 & #-*(7" "#(""-*#&"7&!1*3* *+--(** "##5&-1 ##&!1<=&!("- /  1##" 7 !&&" ##<=##& 6 "* "(1 & #-*("#(""#5  71"&  2019 City Manager and Department Head Pay Plan Exempt from overtime (not eligible for overtime) 1/1/19 Position title Minimum Maximum City Manager: Salary pursuant to employment contract Director of Finance Annual 109,161$ 133,846$ Chief of Police Annual 109,161$ 133,846$ Director of Public Works Annual 109,161$ 133,846$ Community Development Director Annual 109,161$ 133,846$ Director of Comm. Activities, Rec. & Services Annual 109,161$ 133,846$ Fire Chief Annual 109,161$ 133,846$ Deputy City Manager Annual 109,161$ 133,846$ The City Manager is authorized to set salaries within the established ranges. This schedule reflects a 3% increase January 1, 2019                  !"#$%" &  $! %  '(  %! %)*%')!*+,-+%                                   ! "#   "   $ "    " #  %  $ &'   %%./, !"0%%"0) !)"+    10.%, !"0%"%) )+,-+%) 02,,.,!%)%,"."%.*+,-+3"4%1  56   7) 810%"), !"0%"%)".".,,%)%,"!%%%%+% .%)%+)+,-+%.*+,-+3"4%1 56 ) 56 1!! ,!!.."),,/%0- .) +!.0)., !"0%)0+  .,,%)%,"!%%%%+%10, !"0%0-!% , !%0)0.."!"/%,, "")"/0%% 1  !"#!$# 0,,%),3""! )%)/%+)) !+,-+%.0%)! 0 0)"++!.)%0*%10,3"/%,- %!% !%0) 0   "!5   %!   691 4-+ 7  0   "!"-) ,3".% !,)"!!)., !"0 0!)"+    "%)0% +,-+%1 0,3".% !,,-)%)%",."++))+,-+%.00 0)) %+),3" )10,,%)+,-+%%.!!/% %&#!$#:& !!%"% ".!!%%"! )) %,, %!!."")-/,%  + %,-%!!."""  )  ,!"+.%%%,!"+..6%)%!0%/0;!0.< %)  !-) %1 '&# #!$#:*"! )%%!!./%+%/)%!!."" "  ) !!%%),),!"+.<%%+%/%!!./), ),!"+.<%""0 %%)+0!%1 () #!$#:*"! )%,!"+.,,<+!9=,".<%/+ ,,%)%!!./-!-%0)%)/%-"%0%0 ..-!-/0+,")1 *&+&, #!$#:*"! )%"+,!,!"+.%%/,,""%% % " %)%)!%/%-"%,,!%1 &##+" # ',"!%%%%+%,,%)%.%-!. )% "%.0+,-+%!")/00 *%1 4-+ 7  0   "!),)0 5%,"!%%%%+%.% )%+)+,-+%.%)!2),,%10 5%/% !%0) "")"/00 >%',"!%%%%+!"1 0.% !,"! )%,!+%%%%+!!).,,<+!78%)!,,% 02)??% 6)-) !%)!,,%02)??)% 6)-) !"0 "0 ,,0%2)??1'"0)-%),,)<:&!%%%%+!!)&  : %%%%+,.+0,3".% !,1 %%%%+%.& !!'"% " ',"!%%%%+%.6% )-) !%!.+!%)!,,%02)/"!" !) . !! %%%%+%.@897.%+,-+%)@7 A.%+)+,-+%1 02),,%0!00%))%!.+!!"! )=99)- 9 9)- )98 !)"0- /%%%%) %)"+, +<+ + + .% )-) ! !%+%0. !! %%%%++ .%)%+)+,-+%1 -.## ,,/+"0%,,! 3"%,"!%%%%+1*./.!%,,!/00  !$,, !"0%0 !),%,,, !"0) 3"%%%%+ %.."++)%00   "!.% %- 3"%%..., "$0   "!" ), !"01<+,!+0 %% /0 %../ !))%"00 0%.," !"+,!)%%+ !)" +10   "!%0 !)"%)+-0  3"!)%%%%+.+0,,%)!-!!)),0+,,%)%%%%+%1 *.,,!.%,".",,%" !!.!)/0)%"" 0 /!!)-%0   "!.,%.0)!0)%, ),!!%% %1 !%..%/. % %- 3")"++)%,,-!"")!1  !""++%/"! ))0&% !,B,,)<C1' %D !))!, !" "++/%"-).+,,/9)- B%"0)++) +))"+ 7   C1 -+#! $.-!+, "%%%%+!!%),) 0   "!0/."0,,0%0.!!/,+ ,% 10+ .0%,"!%%%%+/0 % /"0)',+ 7  51 1&+ "  50).0 %%%)4-+   5,,/+, 0!%%%%+/0%"!" !).+ "  50).,+1 71,,/+,0%%%%+- 6,)10.%,+/!! ) /0<%   10!,",!/!! , ! !%!!+%1*%=1 ,"%,)0 ,) !"1 81!,,+%B% "0%,0!./)".0 !"C!!/) )0 >% " %%%%+!"1  ##- /-.0#!$#'.."++)%0,% ,-))0   "!,0!)0.%, !"01&!!/0,%, !"0"%) )0+,-+,3"%0 !) ") ")"-, !""++%1 !""++% ""%,"!%%%%+%%0 !) ).)0%"), !"01%! )0 +,-+%) 02,,.,!%)%,"."%%,-)).   "! "%) ,"!%.0.%, !"01 &-.0"&! #.$"0.%,,%)%!  )0,3"%"++))00   "!0") "%"), !"0,,%) %,"!%%%%+%10"0)%! ".%,"!%%%%+%.%)%+) +,-+%.*+,-+3"4%1 56 ) 56 0,  <!!%% ,-)).   "!"%) ,"!%.0%"), !"01  0,,%)%) !+,-+%"! ))0 5 ,!*+,-++10 !,3""%%%+) @ 85  1& )% "%.0,3" )).+% "%% )%" )0,3".% !,,- %!"",) 0   "!4-+ 7  10 %,"!%%%%+%/),) 0   "!4-+ 7  ). )% " + %0"! ))0.% !,!%) !/  &% !,B7 C ',"!%%%%+%@89 87 1 ''/!@A=  1 #!@  1 '+!@995=51 ';0!@5  1 '"% "& )@78991 !@ 85  1 &-1 E%,*-%+%   0HPEHU  LQWURGXFHGWKHIROORZLQJUHVROXWLRQDQGPRYHG LWVDGRSWLRQ   5 ( 6 2 / 8 7 , 2 1  1 2 BBBBBBBBBBBBBB  5(62/87,21 25'(5,1* ,03529(0(176 $1' $87+25,=,1* 35(3$5$7,212)3/$16$1'63(&,),&$7,216)25,03529(0(17 352-(&7 126    $1'  ,17(567$7( $5($ 675((7 67250'5$,1$*($1'87,/,7<,03529(0(176    :+(5($6 WKH %URRNO\Q &HQWHU &LW\ &RXQFLO RQ 0D\   DXWKRUL]HG FRQVLGHUDWLRQRIVWUHHWVWRUPGUDLQDJHDQGXWLOLW\LPSURYHPHQWVLQWKHDUHDJHQHUDOO\GHVFULEHGDV ³,17(567$7($5($´PRUHVSHFLILFDOO\GHVFULEHGDVIROORZVWK$YHQXH1IURP'XSRQW$YHQXH 1WR$OGULFK$YHQXH1VW$YHQXH1IURP'XSRQW$YHQXH1WR/\QGDOH$YHQXH1QG$YHQXH1 IURP'XSRQW$YHQXH1WR/\QGDOH$YHQXH1$OGULFK$YHQXH1IURPWK$YHQXH1WRQG$YHQXH 1%U\DQW$YHQXH1IURPWK$YHQXH1WR/LODF'ULYH1&DPGHQ$YHQXH1IURPWK$YHQXH1WR ¶QRUWKRI&DPGHQ&RXUW&DPGHQ&RXUWIURP&DPGHQ$YHQXH1WR¶HDVWRI&DPGHQ$YHQXH 1&ROID[$YHQXH1IURPWK$YHQXH1WR/LODF'ULYH1/LODF'ULYH1IURP'XSRQW$YHQXH1WR %U\DQW$YHQXH1DQG/\QGDOH$YHQXH1IURPWK$YHQXH1WRQG$YHQXH1DQG  :+(5($6WKH&LW\&RXQFLOKDVUHFHLYHGDQGDFFHSWHGDIHDVLELOLW\UHSRUWIRUVDLG SURSRVHGLPSURYHPHQWVDVSUHSDUHGXQGHUWKH&LW\(QJLQHHU¶VVXSHUYLVLRQDQG  :+(5($6VDLGLPSURYHPHQWVDUHQHFHVVDU\FRVWHIIHFWLYHDQGIHDVLEOHDVGHWDLOHG LQWKHIHDVLELOLW\UHSRUWDQG  :+(5($6WKH&LW\&RXQFLORQ1RYHPEHUDGRSWHGDUHVROXWLRQVHWWLQJD GDWHIRUDSXEOLFKHDULQJUHJDUGLQJWKHSURSRVHGLPSURYHPHQWVIRU,QWHUVWDWH$UHDDQG  :+(5($6WHQGD\VSXEOLVKHGQRWLFHRISXEOLFKHDULQJZDVJLYHQDQGWKHSXEOLF KHDULQJZDVKHOGRQ'HFHPEHUDWZKLFKWLPHDOOSHUVRQVGHVLULQJWREHKHDUGZHUHJLYHQWKH RSSRUWXQLW\WREHKHDUGWKHUHRQDQG  :+(5($6WKH&LW\&RXQFLOKDVFRQVLGHUHGDOOFRPPHQWVWHVWLPRQ\HYLGHQFHDQG UHSRUWVRIIHUHGDWRUSULRUWRWKH'HFHPEHUSXEOLFKHDULQJDQG  :+(5($6WKH&LW\UHDVRQDEO\H[SHFWVWRVSHQGPRQLHVIURPWKH,QIUDVWUXFWXUH &RQVWUXFWLRQ)XQGRQDWHPSRUDU\EDVLVWRSD\WKHH[SHQGLWXUHVGHVFULEHGLQWKLVUHVROXWLRQDQG  :+(5($6WKH&LW\UHDVRQDEO\H[SHFWVWRUHLPEXUVHLWVHOIIRUVXFKH[SHQGLWXUHVIURP WKHSURFHHGVRIWD[DEOHRUWD[H[HPSWERQGVWKHGHEWVHUYLFHRIZKLFKLVH[SHFWHGWREHSDLGIURP SURSHUW\WD[HVVSHFLDODVVHVVPHQWVRUXWLOLW\IHHV7KHPD[LPXPDPRXQWRIVSHFLDODVVHVVPHQW REOLJDWLRQVH[SHFWHGWREHLVVXHGIRUVXFKSURMHFWLVDQG    5(62/87,2112BBBBBBBBBBBBBBB  :+(5($6WKH&LW\(QJLQHHULVSUHSDUHGWRGHYHORSSODQVDQGVSH FLILFDWLRQVIRUVDLG SXEOLFLPSURYHPHQWSURMHFW  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHU0LQQHVRWDWKDW   ,PSURYHPHQW3URMHFW1RVDQG,QWHUVWDWH$UHD6WUHHW 6WRUP'UDLQDJHDQG8WLOLW\,PSURYHPHQWVDUHKHUHE\RUGHUHGDQGWKH&LW\ (QJLQHHU LV DXWKRUL]HG WR SUHSDUH SODQV DQG VSHFLILFDWLRQV IRUVDLG LPSURYHPHQWV   7KLVUHVROXWLRQLVLQWHQGHGWRFRQVWLWXWHRIILFLDOLQWHQWWRLVVXHWD[DEOHRUWD[  H[HPSWUHLPEXUVHPHQWERQGVIRUSXUSRVHVRI7UHDVXU\5HJXODWLRQVDQGDQ\  VXFFHVVRUODZUHJXODWLRQRUUXOLQJ7KLVUHVROXWLRQZLOOEHPRGLILHGWRWKH  H[WHQWUHTXLUHGRUSHUPLWWHGE\7UHDVXU\5HJXODWLRQVRUDQ\VXFFHVVRUODZ  UHJXODWLRQRUUXOLQJ    'HFHPEHU    'DWH    0D\RU   $77(67            &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG   0HPEHU LQWURGXFHGWKHIROORZLQJUHVROXWLRQDQGPRYHG LWVDGRSWLRQ   5(62/87,2112BBBBBBBBBBBBB  5(62/87,21&(57,)<,1*63(&,$/$66(660(176)25,03529(0(17 352-(&7126$1',17(567$7($5($675((7$1' 67250'5$,1$*(,03529(0(176727+(+(11(3,1&2817<7$; 52//6  :+(5($6SXUVXDQWWRSURSHUQRWLFHGXO\JLYHQDVUHTXLUHGE\ODZWKH&LW\&RXQFLO KDVPHWKHDUGDQGSDVVHGXSRQDOOREMHFWLRQVWRWKHSURSRVHG6SHFLDO$VVHVVPHQW/HY\1RV DQGDQG  :+(5($6DVVHVVPHQWUROOVFRSLHVRIZKLFKDUHDWWDFKHGKHUHWRDQGSDUWKHUHRIE\ UHIHUHQFHKDYHEHHQSUHSDUHGE\WKH&LW\(QJLQHHUDQG&LW\&OHUNWDEXODWLQJWKRVHSURSHUWLHVZKHUH VWUHHWLPSURYHPHQWDQGVWRUPGUDLQDJHFRVWVDUHWREHDVVHVVHG  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHU0LQQHVRWDWKDW   6XFKSURSRVHGDVVHVVPHQWV6SHFLDO$VVHVVPHQW/HY\1RIRUVWUHHW  LPSURYHPHQWVDQG6SHFLDO$VVHVVPHQW/HY\1RIRUVWRUPGUDLQDJH  LPSURYHPHQWVPDGHDSDUWKHUHRIDUHKHUHE\DFFHSWHGDQGVKDOOFRQVWLWXWH  VSHFLDODVVHVVPHQWVDJDLQVWODQGVQDPHGWKHUHLQDQGHDFKWUDFWRIODQG  WKHUHLQLQFOXGHGLVKHUHE\IRXQGWREHEHQHILWHGE\WKHLPSURYHPHQWLQWKH  DPRXQWRIWKHDVVHVVPHQWVOHYLHGDJDLQVWLW  6XFKDVVHVVPHQWVVKDOOEHSD\DEOHLQHTXDODQQXDOLQVWDOOPHQWVH[WHQGLQJ RYHUDSHULRGRIWHQ  \HDUVDVLQGLFDWHGRQWKHDVVHVVPHQWUROO7KHILUVWRI WKHLQVWDOOPHQWVVKDOOEHSD\DEOHZLWKDGYDORUHPWD[HVLQDQGVKDOO EHDULQWHUHVWRQWKHHQWLUHDVVHVVPHQWDWWKHUDWHRISHUFHQWSHUDQQXP IURP2FWREHUWKURXJK'HFHPEHU7RHDFKVXEVHTXHQW LQVWDOOPHQWZKHQGXHVKDOOEHDGGHGLQWHUHVWIRURQH\HDURQDOOXQSDLG LQVWDOOPHQWV  7KHRZQHURIDQ\SURSHUW\VRDVVHVVHGPD\DWDQ\WLPHSULRUWRFHUWLILFDWLRQ RIDVVHVVPHQWWRWKH&RXQW\$XGLWRUSD\WKHZKROHDVVHVVPHQWWRWKH&LW\ 7UHDVXUHU ZLWKRXW LQWHUHVW LIHQWLUH DVVHVVPHQW LV SDLG RQ RU EHIRUH 6HSWHPEHU$IWHU6HSWHPEHUKHRUVKHPD\SD\WKHWRWDO DVVHVVPHQWSOXVLQWHUHVW,QWHUHVWZLOODFFXPXODWHIURP2FWREHU WKURXJKWKHGDWHRISD\PHQW6XFKSD\PHQWPXVWEHPDGHE\WKHFORVHRI EXVLQHVV1RYHPEHURULQWHUHVWZLOOEHFKDUJHGWKURXJK'HFHPEHU RIWKHVXFFHHGLQJ\HDU,IWKHRZQHUZLVKHVWRSD\RIIWKHEDODQFHDWVRPH SRLQWLQWKHIXWXUHVXFKSD\PHQWPXVWEHPDGHEHIRUH1RYHPEHURU LQWHUHVWZLOOEHFKDUJHGWKURXJK'HFHPEHURIWKHVXFFHHGLQJ\HDU 5(62/87,2112BBBBBBBBBBBBBBB    7KH&LW\&OHUNVKDOOIRUWKZLWKWUDQVPLWDFHUWLILHGGXSOLFDWHRIWKLVDVVHVVPHQW  WRWKH&RXQW\$XGLWRUWREHH[WHQGHGRQWKHSURSHUWD[OLVWVRIWKHFRXQW\DQG  VXFKDVVHVVPHQWVVKDOOEHFROOHFWHGDQGSDLGRYHULQWKHVDPHPDQQHUDVRWKHU  PXQLFLSDOWD[HV    'HFHPEHU    'DWH    0D\RU   $77(67            &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG    3523(57<,' +286( 675((71$0( /(9< 675((7 /(9< 67250 127(6   7+$9(1    5   67$9(1    5   67$9(1    5   67$9(1    5   67$9(1    5   67$9(1    5   67$9(1    5   1'$9(1    5   1'$9(1    5   1'$9(1     6XEGLYLGDEOH5 HTXLYDOHQW SDUFHOV   1'$9(1    5   1'$9(1    5   1'$9(1     6XEGLYLGDEOH5 HTXLYDOHQW SDUFHOV   1'$9(1    5   1'$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1    5   $/'5,&+$9(1     6XEGLYLGDEOH5 HTXLYDOHQW SDUFHOV   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5 &,7<2)%522./<1&(17(5),1$/$66(660(1752// 'HFHPEHU ,17(567$7($5($5(&216758&7,21 ,03529(0(17352-(&7126$1' 1of4 3523(57<,' +286( 675((71$0( /(9< 675((7 /(9< 67250 127(6 &,7<2)%522./<1&(17(5),1$/$66(660(1752// 'HFHPEHU ,17(567$7($5($5(&216758&7,21 ,03529(0(17352-(&7126$1'   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   %5<$17$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5 2of4 3523(57<,' +286( 675((71$0( /(9< 675((7 /(9< 67250 127(6 &,7<2)%522./<1&(17(5),1$/$66(660(1752// 'HFHPEHU ,17(567$7($5($5(&216758&7,21 ,03529(0(17352-(&7126$1'   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5 6RXWK/RW$GGUHVV3HQGLQJ   &$0'(1$9(1    5 1RUWK/RW   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1$9(1    5   &$0'(1&7    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5 3of4 3523(57<,' +286( 675((71$0( /(9< 675((7 /(9< 67250 127(6 &,7<2)%522./<1&(17(5),1$/$66(660(1752// 'HFHPEHU ,17(567$7($5($5(&216758&7,21 ,03529(0(17352-(&7126$1'   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   &2/)$;$9(1    5   '83217$9(1    5   /,/$&'51    5   /,/$&'51    5   /,/$&'51    5   /,/$&'51    5   /,/$&'51    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5   /<1'$/($9(1    5 7RWDO$VVHVVPHQWV   4of4 694 94 60TH AVE N CA M D E N A V E N BR Y A N T A V E N DU P O N T A V E N CAMDEN CT 59TH AVE N AL D R I C H A V E N 3RD LN N LY N D A L E A V E N EM E R S O N A V E N CO L F A X A V E N LILAC D R N 61ST AVE N 58TH AVE N 62ND AVE N 6240 516 814 6 0 0 5 2 0 5 1 0 5 0 6 5 1 5 5 0 9 22 5837 6041 6035 6031 6023 6015 5821 6007906 6001 5905 5911 6 2 4 2 5919 5957 5929 5945 5953 5959 5815 5951 905 5945 5900 6 2 3 0 5937 5958 5950 5940 5930 5926 5922 5912 505 5935 62 2 0 810 5929 5901 5921 8 0 0 6117 62 20 5 9 3 0 521 6109 6252 6 2 3 8 6101 6233 6000 6042 6006 6012 6024 6018 6030 6036 5937 6127 6 2 1 8 6 2 3 4 62 2 2 5 807 509 62 27 600160006001 6133 6043 6012 6040 6018 6024 5901 6041 6009 6015 6037 6023 6031 6006 6014 6020 6028 6034 6210 611661166117 6035 6029 6021 6015 6007 6220 6228 6132 6115 6114 6115 6114 6115 5943 5900 6 2 0 0 5900 59075906 59155916 5921 5907 5915 5921 5927 5933 5941 5947 5922 59275928 6100 6106 6122 6128 5933 5901 5934 6125 5941 6106 6107 6100 6101 5940 5906 6140 6145 5947 5914 5948 5920 5926 6100 5932 6101 6100 6101 6107 6106 6107 5940 6123 6122 6123 6131 6130 6131 5946 6100 6030 6106 6138 6139 6138 6139 6122 6123 6130 6131 6006 61396138 6001 6001 6043 6000 6007 6015 6019 6025 6031 6037 6000 6042 6006 6012 6018 6024 6030 6036 5901 6128 6042 5942 5919 5925 5931 5937 6043 59 0 0 6200 6201 6200 6201 6207 6206 6207 6215 6214 6215 6221 6220 6221 6227 6224 6225 6230 6233 6236 6237 59 4 2 5907 5913 580 1 6139 5 91 6 6013 6019 6025 6031 6037 6 2 0 0 6107 6007 6234 6240 6246 6215 6221 22 Legend Proposed Single R1 Assessment Proposed Multiple R1 Assessments Previously Assessed Assessment Map Interstate Area Street and Utility Improvements December 2018 M E M O R A N D U M DATE: December 3, 2018 TO: Curt Boganey, City Manager THROUGH: Doran Cote, P.E., Director of Public Works FROM: Mike Albers, P.E., City Engineer SUBJECT: Resident Survey Comment Update – Interstate Area Street and Utility Improvements, Project Nos. 2019-01, 02, 03 and 04 This memo supplements Appendix B (Resident Comments) of the feasibility report for the Interstate Area Street and Utility Improvements dated November 5, 2018. Please see the attached letter from the property owner at 509 62nd Avenue regarding the potential new sidewalk along 62nd Avenue from Dupont Avenue to Lyndale Avenue. This information is an additional comment received subsequent to the City Council accepting the feasibility report on November 13, 2018. OE"WFOVF Ci t y o f B r o o k l y n C e n t e r In t e r s t a t e A r e a St r e e t a n d U t i l i t y I m p r o v e m e n t s ( 2 0 1 9 ) Pu b l i c H e a r i n g s De c e m b e r 1 0 , 2 0 1 8 Pu b l i c I m p r o v e m e n t H e a r i n g : Sp e c i a l A s s e s s m e n t s : ƒ Lo c a l p u b l i c i m p r o v e m e n t s t o t h e C i t y ’ s in f r a s t r u c t u r e b a s e d o n S t a t e o f M i n n e s o t a S t a t u t e Ch a p t e r 4 2 9 ƒ In t e r s t a t e A r e a S t r e e t & U t i l i t y I m p r o v e m e n t s , Pr o j e c t N o s . 2 0 1 9 - 01 , 0 2 , 0 3 & 0 4 In t e r s t a t e A r e a R e c o n s t r u c t i o n P r o j e c t Ca p i t a l I m p r o v e m e n t P r o g r a m ƒ Ci t y I n i t i a t e d P r o g r a m i n 19 9 3 ƒ Re c o n s t r u c t A g i n g P u b l i c St r e e t s a n d U t i l i t i e s ƒ 92 . 5 m i l e s ( 8 8 % ) Co m p l e t e d ƒ 20 1 9 w i l l b e t h e 2 6 t h Y e a r ƒ Pr o j e c t e d C o m p l e t i o n 20 2 1 ƒ 13 . 1 M i l e s R e m a i n i n g ƒ Es t . C o s t 2 0 1 9 - 2 0 3 3 C I P : $2 0 1 m i l l i o n Pr o j e c t P l a n n i n g Pr o j e c t E v a l u a t i o n ƒ Sa n i t a r y S e w e r ƒ Wa t e r M a i n ƒ St o r m D r a i n a g e ƒ St r e e t s , S i d e w a l k s , T r a i l s ƒ St r e e t L i g h t s ƒ Ot h e r Sa n i t a r y S e w e r Co l l e c t i o n S y s t e m ƒ Co l l e c t i o n S y s t e m I n s t a l l e d i n 19 6 0 , 1 9 6 2 , 1 9 6 4 , 1 9 6 5 a n d 19 7 2 ƒ Ma i n l y 8 ” V C P , s o m e 8 ” P V C ƒ Ro o t I n t r u s i o n - r o o t s a w i n g re q u i r e d t o m a i n t a i n co n v e y a n c e c a p a c i t y ( 9 5 % ) ƒ Co n d i t i o n S u r v e y / T e l e v i s i n g In s p e c t i o n s ( cr a c k e d p i p e , sa g s ) Pr o p o s e d I m p r o v e m e n t s ƒ Ne w t r u n k s e w e r s w i t h i n st r e e t s ƒ Re p l a c e s e r v i c e l i n e s u p t o pr o p e r t y l i n e w i t h i n s t r e e t s ƒ Di s t r i b u t i o n S y s t e m I n s t a l l e d : 1 9 6 4 , 19 6 9 a n d 1 9 7 2 ƒ 6” a n d 8 ” C I P ƒ 24 ” S t e e l o n C o l f a x A v e ƒ Ca s t I r o n P i p e w i t h c e m e n t l i n e r – i n re l a t i v e l y g o o d c o n d i t i o n ( c o u p l e is s u e a r e a s ) ƒ Is s u e s - U n d e r m i n i n g Ca s t I r o n P i p e (d u r i n g s a n i t a r y s e w e r r e p l a c e m e n t ) Pr o p o s e d I m p r o v e m e n t s ƒ Re p l a c e v a l v e s a n d h y d r a n t s th r o u g h o u t p r o j e c t a r e a ƒ Re p l a c e m e n t o f W a t e r M a i n ( w h e r e ad j a c e n t t o d e e p s a n i t a r y s e w e r re p l a c e m e n t a n d s t e e l l i n e o n Co l f a x : a p p r o x . 6 0 % - 7 0 % ) ƒ Re p l a c e s e r v i c e l i n e s u p t o p r o p e r t y li n e , C u r b S t o p s Di s st r i b u t i o n n ys t e m I n s t a l l e d Sy : 96 4 19 Wa t e r D i s t r i b u t i o n S y s t e m St o r m W a t e r Dr a i n a g e S y s t e m ƒ Ex i s t i n g s t o r m s e w e r s y s t e m i s de v e l o p e d t h r o u g h o u t ne i g h b o r h o o d – s o m e s t a n d i n g w a t e r o n r o a d e d g e s a n d a t in t e r s e c t i o n s ƒ Ex p a n s i o n o f s y s t e m n e e d e d ƒ Co o r d i n a t i o n w i t h w a t e r a n d s e w e r re p l a c e m e n t Pr o p o s e d I m p r o v e m e n t s ƒ Re m o v e a n d R e p l a c e S t o r m St r u c t u r e s a n d P i p e A s N e e d e d ƒ Ex t e n d n e w c a t c h b a s i n s a n d s t o r m se w e r p i p e w h e r e f e a s i b l e ƒ Wa t e r q u a l i t y t r e a t m e n t : s u m p ca t c h b a s i n s , r a i n g a r d e n s , o t h e r im p r o v e m e n t s w h e r e f e a s i b l e Pa v e m e n t C o n d i t i o n v s . D r a i n a g e ( T y p i c a l ) Pa v e m e n t C o n d i t i o n ƒ Su b g r a d e ( F o u n d a t i o n ) Co n d i t i o n – g o o d c o n d i t i o n ƒ Dr a i n a g e i s s u e s ƒ Ma t e r i a l D e t e r i o r a t i o n St r e e t R e c o n s t r u c t i o n Pr o p o s e d I m p r o v e m e n t s ƒ Ne w C u r b a n d G u t t e r ƒ Fu l l D e p t h P a v e m e n t a n d Ag g r e g a t e B a s e ƒ Re c o n s t r u c t i o n 3 0 f e e t w i d e fo r a l l s t r e e t e x c e p t L i l a c Dr i v e ƒ Re c o n s t r u c t i o n L i l a c D r i v e 28 f e e t w i d e ( D u p o n t A v e t o Br y a n t A v e ) Si d e w a l k Im p r o v e m e n t s ƒ Re p l a c e P e d e s t r i a n C u r b Ra m p s a t E x i s t i n g Si d e w a l k s o n 5 9 th Av e a n d Du p o n t A v e a s n e e d e d ƒ Po t e n t i a l n e w 6 ’ c o n c r e t e si d e w a l k a l o n g n o r t h s i d e of 6 2 nd Av e f r o m D u p o n t Av e t o L y n d a l e A v e Ci t y P o l i c i e s a n d S t u d i e s Ex i s t i n g C o n d i t i o n s a n d P r o p o s e d I m p r o v e m e n t s Ex i s t i n g C o n d i t i o n s a n d P r o p o s e d I m p r o v e m e n t s Ex i s t i n g C o n d i t i o n s a n d P r o p o s e d I m p r o v e m e n t s Re s t o r a t i o n Re s t o r a t i o n ƒ Dr i v e w a y s t h a t a r e d i s t u r b e d d u e t o t h e st r e e t r e c o n s t r u c t i o n w i l l b e r e p l a c e d . ƒ Di s t u r b e d b o u l e v a r d a r e a s w i l l b e re s t o r e d w i t h t o p s o i l a n d s o d . ƒ Tr e e r e p l a c e m e n t o n 1 : 1 r a t i o i n f a l l St r e e t L i g h t i n g ƒ Re p l a c e 1 1 F r e e - S t a n d i n g St r e e t L i g h t s w i t h F i b e r g l a s s Po l e s a n d L E D l i g h t f i x t u r e s ƒ Ex i s t i n g L i g h t s o n M u l t i - U s e Po l e s t o R e m a i n Pu b l i c R i g h t - o f - W a y ƒ Ri g h t - o f - w a y a n d e a s e m e n t s ar e d e d i c a t e d t o t h e p u b l i c f o r co n s t r u c t i o n a n d m a i n t e n a n c e of s t r e e t s a n d u t i l i t i e s ƒ De l i n e a t e d o n s u b d i v i s i o n pl a t s . ƒ Ty p i c a l r i g h t - o f - w a y w i d t h ƒ 60 ’ f o r I n t e r s t a t e A r e a ƒ Ri g h t - o f - w a y e d g e i s ap p r o x . 1 5 ’ b e y o n d t h e ed g e o f s t r e e t p a v e m e n t / ba c k o f c u r b . Du r i n g C o n s t r u c t i o n - I n c o n v e n i e n c e Pr e l i m i n a r y P r o j e c t B u d g e t CI P – E s t . P e r c e n t P r o j e c t A m o u n t T o t a l Sp e c i a l A s s e s s m e n t s $ 1 , 4 6 0 , 4 3 0 . 0 0 1 3 . 9 % Sa n i t a r y S e w e r U t i l i t y $ 1 , 7 5 0 , 0 0 0 . 0 0 1 6 . 7 % Wa t e r U t i l i t y $ 2 , 1 0 0 , 0 0 0 . 0 0 2 0 . 0 % St o r m D r a i n a g e U t i l i t y $ 1 , 6 6 2 , 9 5 9 . 0 0 1 5 . 8 % St r e e t L i g h t U t i l i t y $ 9 0 , 0 0 0 . 0 0 0 . 9 % St r e e t R e c o n s t r u c t i o n F u n d $ 3 , 4 2 6 , 6 1 1 . 0 0 3 2 . 7 % To t a l $ 1 0 , 4 9 0 , 0 0 0 . 0 0 1 0 0 % No t e : T h e s e a r e o n l y p r e l i m i n a r y e s t i m a t e d a m o u n t s Pr e l i m i n a r y As s e s s m e n t A r e a Sp e c i a l A s s e s s m e n t s - E s t i m a t e d A m o u n t s & Pa y m e n t O p t i o n s Fu l l S t r e e t R e c o n s t r u c t i o n w i t h N e w C u r b a n d G u t t e r ƒ 20 1 8 A s s e s s m e n t R a t e s f o r R 1 p r o p e rt i e s : $ 4 , 6 2 3 ( s t r e e t ) + $ 1 , 3 87 ( d r a i n a g e ) = $6 , 0 1 0 ƒ Su b - d i v i s i b l e R 1 p r o p e r t i e s t o b e c h a r g e d f o r a d d i t i o n a l p r o p e r ty ƒ 20 1 9 I n t e r e s t R a t e : 5 . 0 % 1. Pa y i n f u l l - N o i n t e r e s t b e t w e e n Ma r c h a n d S ep t e m b e r 3 0 , 2 0 1 9 2. Pa y i n f u l l f r o m O c t o b e r 1 t o N o ve m b e r 2 0 , 2 0 1 9 , w i t h i n t e r e s t fr o m O c t o b e r 1 3. Pa y i n i n s t a l l m e n t s w i t h p r o p e r t y t a x e s o v e r a 1 0 - y e a r p e r i o d s ta r t i n g i n 2 0 2 0 Pa r t i a l p r e p a y m e n t s c a n n o t b e a c c e p t e d If a p r o j e c t i s a p p r o v e d a n A ss e s s m e n t R e m i n d e r L e t t e r w i l l b e se n t Es t i m a t e d P a y m e n t A m o u n t No t e : T h e s e a r e o n l y p r e l i m i n a r y e s t i m a t e d a m o u n t s – t h e s e am o u n t s w i l l c h a n g e d e p e n d e n t o n w h e n i n t e r e s t s t a r t s ac c r u i n g . A p p r o x i m a t e m o n t h l y p a y m e n t r a n g e s f r o m $ 5 3 - $ 8 2 . Pr e l i m i n a r y P r o j e c t S c h e d u l e ƒ Ne i g h b o r h o o d I n f o r m a t i o n M e e t i n g O c t o b e r 2 4 , 2 0 1 8 ƒ Co u n c i l R e c e i v e s F e a s i b i l i t y R e p o r t N o v e m b e r 1 3 , 2 0 1 8 ƒ Co n d u c t P u b l i c H e a r i n g / O r d e r P l a n s D e c e m b e r 1 0 , 2 0 1 8 ƒ Ap p r o v e P l a n s / A d v e r t i s e fo r B i d s F e b r u a r y 2 0 1 9 ƒ Ac c e p t B i d s / A w a r d P r o je c t M a r c h / A p r i l 2 0 1 9 ƒ Be g i n C o n s t r u c t i o n A p r i l 2 0 1 9 ƒ Su b s t a n t i a l C o m p l e t i o n O c t o b e r 2 0 1 9 ƒ Tr e e R e p l a c e m e n t s F a l l 2 0 1 9 St a f f R e c o m m e n d a t i o n s : - A u t h o r i z e P r o j e c t - C e r t i f y S p e c i a l A s s e s s m e n t s De c e m b e r 1 0 , 2 0 1 8 Ci t y o f B r o o k l y n C e n t e r In t e r s t a t e A r e a St r e e t a n d U t i l i t y I m p r o v e m e n t s ( 2 0 1 9 )                   !!" ## $%  &'  !(!)&& #$'"'*+& "  '+,' & * "&'!-'#-.#/"0 &-,- &  &$ & !012 /00*! ,&+" !(! 3# "'*+!"&"'"# ,&/-*"+!$#  !&","&4!&0#!"&/"0 0*'+  ! #&4!&0#!5                                        !  !" #     $   %&'#    (          #     )    #     )    *  6,"-&!0!&7 &" !(+,! +8' +!&& #+ #" 9"&+#!*,0*,"7 00+-'#&"9 '"5 -'#& ++"9''4!,"*'0,'#":;2* !8' 5   #9   6,"-&!0& 9,"00'#+#" * 9"0.# +#'4!!00'#9'+5 &++"9"!**4"!00'#"##  !,&!#&+!! <&#" "9",&* "'&5  ",&* "'&#' "  !0.#&9#,09'4!!*''"*'0,0'&"9.#*&+! "+! !9!"4!#!!0.#&'#"5 !0.#&&+! !! 4&!&"*'0"*'04!#!4 #,0',&"*'0,0'&0'#+! 5 )& '& ! <&   &&&  9 &&& 30&&  '#& 4! !  4!  # 9 &!4 ! & #! 4 '" !*  & 9&'+*9',0#,0',39&9!5  &' &!0 9'#!+#,9 !  4&00*"9   #' *,91  5  !&'  !(&,3, ,0#0', +!"&9&& "+#! 0.#+=>;  5  9+0&!0#&&"0.#4''90&"&" #!0 9'#!5& 0+!" #?'&!@#-&"+ &*'0,+! ,,  & *'0, 0A0&-'#B4''0&040!00&"+#" 0.#5  !'",&*+!! 4''#*+!&& #4''9003,'=2:; 5! "&4''#& #!'# ,9#''7 9' 000+8' 5!&& #+!"&4''++#! <&#"5  ! ""*'0,  Y-6%%5 &RXQFLO0HPEHUL Q W URGXFHG WKH IROORZLQJ UHVROXWLRQ DQGPRYHGLWVDGRSWLRQ  5(62/87,21BBBBBBBBBBB $87+25,=,1*7+(,668$1&(6$/($1''(/,9(5<2),76&21'8,7 08/7,)$0,/<+286,1*5(9(18(%21'65(/$7,1*727+(81,7< 3/$&(352-(&7$'237,1*$+286,1*352*5$038568$1772 0,11(627$67$787(6&+$37(5&$33529,1*7+()25062) $1'$87+25,=,1*7+((;(&87,21$1''(/,9(5<2)7+(%21'6 $1'5(/$7(''2&80(1763529,',1*)257+(6(&85,7<5,*+76 $1'5(0(',(6:,7+5(63(&7727+(%21'6$1'*5$17,1* $33529$/)25&(57$,127+(5$&7,216:,7+5(63(&77+(5(72   :+(5($6WKH&LW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH³&LW\´ LVDKRPHUXOHFKDUWHUFLW\GXO\ RUJDQL]HGDQGH[LVWLQJXQGHULWV&KDUWHUDQGWKH&RQVWLWXWLRQDQGODZVRIWKH6WDWHRI0LQQHVRWDDQG   :+(5($6SXUVXDQWWR0LQQHVRWD6WDWXWHV&KDSWHU&DVDPHQGHG WKH³$FW´ WKH&LW\LV DXWKRUL]HGWRFDUU\RXWWKHSXEOLFSXUSRVHVGHVFULEHGLQWKH$FWE\LVVXLQJUHYHQXHERQGVDQGQRWHVRU RWKHUREOLJDWLRQVWRILQDQFHRUUHILQDQFHPXOWLIDPLO\KRXVLQJGHYHORSPHQWVORFDWHGZLWKLQWKH&LW\DQG DV D FRQGLWLRQ WR WKH LVVXDQFH RI VXFK UHYHQXH REOLJDWLRQV DGRSW D KRXVLQJ SURJUDP SURYLGLQJ WKH LQIRUPDWLRQUHTXLUHGE\6HFWLRQ&VXEGLYLVLRQDRIWKH$FWDQG   :+(5($6LQWKHLVVXDQFHRIWKH&LW\¶VUHYHQXHREOLJDWLRQVDQGLQWKHPDNLQJRIDORDQWR ILQDQFHDPXOWLIDPLO\KRXVLQJGHYHORSPHQWWKH&LW\PD\H[HUFLVHZLWKLQLWVFRUSRUDWHOLPLWVDQ\RIWKH SRZHUVWKDWWKH0LQQHVRWD+RXVLQJ)LQDQFH$JHQF\PD\H[HUFLVHXQGHU0LQQHVRWD6WDWXWHV&KDSWHU $ DV DPHQGHG ZLWKRXW OLPLWDWLRQ XQGHU WKH SURYLVLRQV RI 0LQQHVRWD 6WDWXWHV &KDSWHU  DV DPHQGHGDQG  :+(5($6 8QLW\ /LPLWHG 3DUWQHUVKLS D 0LQQHVRWD OLPLWHG SDUWQHUV K L S  R U R Q H R U P R U H  DIILOLDWHGHQWLWLHVWREHFUHDWHGFROOHFWLYHO\WKH³%RUURZHU´ KDVUHTXHVWHGWKDWWKH&LW\LVVXHLWVUHYHQXH ERQGVSXUVXDQWWRWKH$FWLQDQDJJUHJDWHDPRXQWQRWWRH[FHHGLQRQHRUPRUHVHULHVDW RQHWLPHRUIURPWLPHWRWLPH WKH³%RQGV´ DQGOHQGWKHSURFHHGVWKHUHRIWRWKH%RUURZHUWR L ILQDQFH WKH DFTXLVLWLRQ UHQRYDWLRQ FRQVWUXFWLRQ DQG HTXLSSLQJ RI DQDSSUR[LPDWHO\ XQLW UHQWDO KRXVLQJ IDFLOLW\DQGUHODWHGDPHQLWLHVORFDWHGDW8QLW\$YHQXH1RUWKLQWKH&LW\ WKH³3URMHFW´  LL IXQGRQH RUPRUHUHVHUYHIXQGVWRVHFXUHWKHWLPHO\SD\PHQWRIWKH%RQGVLIQHFHVVDU\ LLL SD\LQWHUHVWRQWKH %RQGVGXULQJWKHUHQRYDWLRQRIWKH3URMHFWLIQHFHVVDU\DQG LY SD\WKHFRVWVRILVVXLQJWKH%RQGVDQG  :+(5($6 RQ 1RYHPEHU   WKH &LW\ &RXQFLO DGRSWHG D SUHOLPLQDU\ UHVROXWLRQ WKH ³3UHOLPLQDU\5HVROXWLRQ´ ZKLFKFRQVWLWXWHVDUHLPEXUVHPHQWUHVROXWLRQDQGDQRIILFLDOLQWHQWRIWKH&LW\ WRUHLPEXUVHH[SHQGLWXUHVZLWKUHVSHFWWRWKH3URMHFWIURPWKHSURFHHGVRIWD[H[HPSWUHYHQXHERQGVLQ DFFRUGDQFHZLWKWKHSURYLVLRQVRI7UHDVXU\5HJXODWLRQV6HFWLRQDQG  :+(5($6 WKH ,VVXHU LV VHHNLQJ DOORFDWLRQ RI WKH ERQGLQJ DXWKRULW\ IURP 0LQQHVRWD 0DQDJHPHQWDQG%XGJHW ³00%´ DOORFDWLQJYROXPHFDSERQGLQJDXWKRULW\WRWKH&LW\LQWKHDPRXQWRI IRULVVXDQFHRIWKH%RQGVDQGQR%RQGVZLOOEHLVVXHGXQWLOWKH&LW\UHFHLYHVDQDOORFDWLRQRI WKHERQGLQJDXWKRULW\DQG  :+(5($6WKH&LW\KDVSUHSDUHGDKRXVLQJSURJUDPSURYLGLQJWKHLQIRUPDWLRQUHTXLUHGE\ 6HFWLRQ&VXEGLYLVLRQDRIWKH$FW WKH³+RXVLQJ3URJUDP´ UHJDUGLQJWKHLVVXDQFHE\WKH&LW\   Y-6%%5 RIRQHRUPRUHUHYHQXHREOLJDWLRQVLQWKHPD[LPXPSULQFLSDODPRXQWRIWRILQDQFHWKH DFTXLVLWLRQUHQRYDWLRQFRQVWUXFWLRQDQGHTXLSSLQJRIWKH3URMHFWDQG  :+(5($6DQRWLFHRISXEOLFKHDULQJ WKH³3XEOLF1RWLFH´ ZDVSXEOLVKHGLQDFFRUGDQFHZLWK WKH$FWDQG6HFWLRQ I RIWKH,QWHUQDO5HYHQXH&RGHRIDVDPHQGHG WKH³&RGH´ ZLWKUHVSHFW WR L WKHUHTXLUHGSXEOLFKHDULQJXQGHUWKH&RGH LL WKHUHTXLUHGSXEOLFKHDULQJXQGHU6HFWLRQ& VXEGLYLVLRQRIWKH$FW LLL WKH+RXVLQJ3URJUDPDQG LY DSSURYDORIWKHLVVXDQFHRIWKH1RWHDQGRQ WKLVVDPHGDWHWKH&LW\&RXQFLOFRQGXFWHGDSXEOLFKHDULQJRQWKHGDWHKHUHRIDWZKLFKDUHDVRQDEOH RSSRUWXQLW\ZDVSURYLGHGIRULQWHUHVWHGLQGLYLGXDOVWRH[SUHVVWKHLUYLHZVERWKRUDOO\DQGLQZULWLQJDQG   :+(5($6WKH%RQGVZLOOEHLVVXHGSXUVXDQWWRWKLV5HVROXWLRQDQGWKH%RQGVDQGWKHLQWHUHVW RQWKH%RQGV L VKDOOEHSD\DEOHVROHO\IURPWKHUHYHQXHVSOHGJHGWKHUHIRUXQGHUWKH/RDQ$JUHHPHQW DQGWKH,QGHQWXUH LL VKDOOQRWFRQVWLWXWHDGHEWRIWKH&LW\ZLWKLQWKHPHDQLQJRIDQ\FRQVWLWXWLRQDORU VWDWXWRU\OLPLWDWLRQ LLL VKDOOQRWFRQVWLWXWHQRUJLYHULVHWRDSHFXQLDU\OLDELOLW\RIWKH&LW\RUDFKDUJH DJDLQVWLWVJHQHUDOFUHGLWRUWD[LQJSRZHUV LY VKDOOQRWFRQVWLWXWHDFKDUJHOLHQRUHQFXPEUDQFHOHJDORU HTXLWDEOH XSRQ DQ\ SURSHUW\ RI WKH &LW\ RWKHU WKDQ WKH &LW\¶VLQWHUHVW LQ WKH /RDQ $JUHHPHQW DQG Y VKDOOQRWFRQVWLWXWHDJHQHUDORUPRUDOREOLJDWLRQRIWKH&LW\DQG  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLO WKH³&RXQFLO´ RIWKH&LW\RI %URRNO\Q&HQWHU0LQQHVRWD WKH³&LW\´ DVIROORZV  )LQGLQJV7KH&LW\DFNQRZOHGJHVILQGVGHWHUPLQHVDQGGHFODUHVWKDWWKHLVVXDQFHRIWKH %RQGVLVDXWKRUL]HGE\WKH$FWDQGLVFRQVLVWHQWZLWKWKHSXUSRVHVRIWKH$FWDQGWKDWWKHLVVXDQFHRIWKH %RQGVDQGWKHRWKHUDFWLRQVRIWKH&LW\XQGHUWKH,QGHQWXUHWKH/RDQ$JUHHPHQWDQGWKLVUHVROXWLRQ FRQVWLWXWHDSXEOLFSXUSRVHDQGDUHLQWKHLQWHUHVWVRIWKH&LW\7KH3URMHFWFRQVWLWXWHVD³TXDOLILHG UHVLGHQWLDOUHQWDOSURMHFW´ZLWKLQWKHPHDQLQJRI6HFWLRQ G RIWKH&RGHDQGD³PXOWLIDPLO\KRXVLQJ GHYHORSPHQW´DXWKRUL]HGE\WKH$FWDQGIXUWKHUVWKHSXUSRVHVRIWKH$FW,QDXWKRUL]LQJWKHLVVXDQFHRI WKH%RQGVIRUWKHILQDQFLQJRIWKH3URMHFWDQGWKHUHODWHGFRVWVWKH&LW\¶VSXUSRVHLVDQGWKHHIIHFWWKHUHRI ZLOOEHWRSURPRWHWKHSXEOLFZHOIDUHRIWKH&LW\DQGLWVUHVLGHQWVE\SURYLGLQJRUSUHVHUYLQJDIIRUGDEOH PXOWLIDPLO\ KRXVLQJ GHYHORSPHQWV IRU ORZ RU PRGHUDWH LQFRPH UHVLGHQWV RI WKH &LW\ DQG RWKHUZLVH IXUWKHULQJWKHSXUSRVHVDQGSROLFLHVRIWKH$FW  )LQDQFLQJ6WUXFWXUH7KH%RUURZHUKDVUHTXHVWHGWKDWWKH&LW\LVVXHVHOODQGGHOLYHUWKH %RQGVSXUVXDQWWRD7UXVW,QGHQWXUHGDWHGRQRUDIWHU-DQXDU\ WKH³,QGHQWXUH´ EHWZHHQWKH ,VVXHUDQG86%DQN1DWLRQDO$VVRFLDWLRQ WKH³7UXVWHH´ DVWKH0XOWLIDPLO\+RXVLQJ5HYHQXH%RQGV 8QLW\3ODFH3URMHFW 6HULHVWREHSXUFKDVHGE\'RXJKHUW\ &RPSDQ\//& WKH³8QGHUZULWHU´  SXUVXDQWWRWKH%RQG3XUFKDVH$JUHHPHQWGDWHGRQRUDIWHUWKHGDWHWKLV5HVROXWLRQLVDSSURYHG WKH ³%RQG3XUFKDVH$JUHHPHQW´ DPRQJWKH8QGHUZULWHUWKH&LW\DQGWKH%RUURZHUDQGWKHSURFHHGV GHULYHGIURPWKHVDOHRIWKH%RQGVZLOOEHORDQHGE\WKH&LW\WRWKH%RUURZHUWRILQDQFHDSRUWLRQRIWKH FRVWRIWKH3URMHFWSXUVXDQWWRWKHWHUPVRID/RDQ$JUHHPHQWGDWHGRQRUDIWHU-DQXDU\E\DQG EHWZHHQWKH%RUURZHUDQGWKH&LW\ WKH³/RDQ$JUHHPHQW´ 3XUVXDQWWRWKH/RDQ$JUHHPHQWWKH&LW\ ZLOOORDQWKHSURFHHGVRIWKH%RQGVWRWKH%RUURZHU7KHSD\PHQWVWREHPDGHE\WKH%RUURZHUXQGHU WKH/RDQ$JUHHPHQWDUHIL[HGVRDVWRSURGXFHUHYHQXHVXIILFLHQWWRSD\WKHSULQFLSDORISUHPLXPLIDQ\ DQGLQWHUHVWRQWKH%RQGVZKHQGXH:KHQH[HFXWHGWKHULJKWWLWOHDQGLQWHUHVWRIWKH&LW\LQWRDQG XQGHUDPRQJRWKHUWKLQJVWKH/RDQ$JUHHPHQW H[FHSWDVWKHUHLQSURYLGHG ZLOOEHDVVLJQHGWRWKH 7UXVWHHSXUVXDQWWRWKH,QGHQWXUH7KH%RQGVVKDOOEHDULQWHUHVWDWWKHUDWHVVKDOOEHQXPEHUHGVKDOOEH GDWHGVKDOOPDWXUHVKDOOEHVXEMHFWWRUHGHPSWLRQSULRUWRPDWXULW\DQGVKDOOEHLQVXFKIRUPDQGKDYH VXFKRWKHUGHWDLOVDQGSURYLVLRQVDVPD\EHSUHVFULEHGLQWKH,QGHQWXUHDVH[HFXWHGLQDFFRUGDQFHZLWK 6HFWLRQVDQG7KH7UXVWHHLVKHUHE\DSSRLQWHGDVWKH3D\LQJ$JHQWDQGWKH%RQG5HJLVWUDUIRUWKH %RQGV    Y-6%%5 $XWKRUL]DWLRQRI%RQGV6XEMHFWWRUHFHLYLQJDOORFDWLRQRIWKHERQGLQJDXWKRULW\IURP 00%IRUWKHSXUSRVHVVHWIRUWKDERYHWKHUHLVKHUHE\DXWKRUL]HGWKHLVVXDQFHVDOHDQGGHOLYHU\RIWKH %RQGVLQRQHRUPRUHVHULHVLQDSULQFLSDODPRXQWQRWWRH[FHHGWKHOHVVHURIRUWKHDPRXQW RIERQGLQJDXWKRULW\DOORFDWHGWRWKH&LW\E\00%7KH%RQGVVKDOOEHDULQWHUHVWDWWKHUDWHVVKDOOEH GHVLJQDWHGVKDOOEHQXPEHUHGVKDOOEHGDWHGVKDOOPDWXUHVKDOOEHLQWKHDJJUHJDWHSULQFLSDODPRXQW VKDOOEHVXEMHFWWRUHGHPSWLRQSULRUWRPDWXULW\VKDOOEHLQVXFKIRUPDQGVKDOOKDYHVXFKRWKHUWHUPV GHWDLOVDQGSURYLVLRQVDVDUHSUHVFULEHGLQWKH,QGHQWXUHLQVXEVWDQWLDOO\WKHIRUPQRZRQILOHZLWKWKH &LW\ZLWKDQ\QHFHVVDU\DQGDSSURSULDWHYDULDWLRQVRPLVVLRQVDQGLQVHUWLRQV LQFOXGLQJFKDQJHVWRWKH DJJUHJDWHSULQFLSDODPRXQWRIWKH%RQGVWKHVWDWHGPDWXULW\RIWKH%RQGVWKHLQWHUHVWUDWHRUUDWHVRQWKH %RQGVDQGWKHWHUPVRIUHGHPSWLRQRIWKH%RQGV DVDUHDSSURYHGDVHYLGHQFHGE\WKHH[HFXWLRQWKHUHRI DVSURYLGHGLQ6HFWLRQVDQG6XEMHFWWRUHFHLYLQJDOORFDWLRQRIWKHERQGLQJDXWKRULW\IURP00%WKH &LW\KHUHE\DXWKRUL]HVWKH%RQGVWREHLVVXHGLQZKROHRULQSDUWDV³WD[H[HPSWERQGV´WKHLQWHUHVWRQ ZKLFKLVH[FOXGDEOHIURPJURVVLQFRPHIRUIHGHUDODQG6WDWHRI0LQQHVRWDLQFRPHWD[SXUSRVHVSURYLGHG WKDWLIQHFHVVDU\FHUWDLQ%RQGVPD\EHLVVXHGDVWD[DEOHREOLJDWLRQV  7KH&RXQFLOKHUHE\DXWKRUL]HVDQGGLUHFWVWKHH[HFXWLRQRIWKH%RQGVLQDFFRUGDQFHZLWKWKH WHUPVRIWKH,QGHQWXUHDQGKHUHE\SURYLGHVWKDWWKH,QGHQWXUHVKDOOSURYLGHWKHWHUPVDQGFRQGLWLRQV FRYHQDQWVULJKWVREOLJDWLRQVGXWLHVDQGDJUHHPHQWVRIWKHRZQHUVRIWKH%RQGVWKH&LW\DQGWKH 7UXVWHHDVVHWIRUWKWKHUHLQ7KH7UXVWHHLVKHUHE\DSSRLQWHGDVWKH3D\LQJ$JHQWDQGWKH%RQG5HJLVWUDU IRUWKH%RQGV  $OORIWKHSURYLVLRQVRIWKH%RQGVZKHQH[HFXWHGDVDXWKRUL]HGKHUHLQVKDOOEHGHHPHGWREHD SDUWRIWKLV5HVROXWLRQDVIXOO\DQGWRWKHVDPHH[WHQWDVLILQFRUSRUDWHGYHUEDWLPKHUHLQDQGVKDOOEHLQ IXOOIRUFHDQGHIIHFWIURPWKHGDWHRIH[HFXWLRQDQGGHOLYHU\WKHUHRI7KH%RQGVVKDOOEHVXEVWDQWLDOO\LQ WKHIRUPLQWKH,QGHQWXUHRQILOHZLWKWKH&LW\ZKLFKIRUPLVKHUHE\DSSURYHGZLWKVXFKQHFHVVDU\DQG DSSURSULDWHYDULDWLRQVRPLVVLRQVDQGLQVHUWLRQV LQFOXGLQJFKDQJHVWRWKHDJJUHJDWHSULQFLSDODPRXQWRI WKH%RQGVWKHVWDWHGPDWXULWLHVRIWKH%RQGVWKHLQWHUHVWUDWHVRQWKH%RQGVDQGWKHWHUPVRIUHGHPSWLRQ RI WKH %RQGV  DV WKH 0D\RU DQG WKH &LW\ 0DQDJHU WKH ³&LW\ 2IILFLDOV´  LQ WKHLU GLVFUHWLRQ VKDOO GHWHUPLQH7KHH[HFXWLRQRIWKH%RQGVZLWKWKHPDQXDORUIDFVLPLOHVLJQDWXUHVRIWKH&LW\2IILFLDOVDQG WKHGHOLYHU\RIWKH%RQGVE\WKH&LW\VKDOOEHFRQFOXVLYHHYLGHQFHRIVXFKGHWHUPLQDWLRQ  /LPLWDWLRQRI/LDELOLW\7KH%RQGVVKDOOEHVSHFLDOOLPLWHGUHYHQXHREOLJDWLRQVRIWKH &LW\SD\DEOHVROHO\IURPWKHUHYHQXHVSURYLGHGE\WKH%RUURZHUSXUVXDQWWRWKH/RDQ$JUHHPHQWDQG RWKHUIXQGVSOHGJHGSXUVXDQWWRWKHDSSOLFDEOH)LQDQFLQJ'RFXPHQWVWKH&LW\GRHVQRWSOHGJHLWVJHQHUDO FUHGLWRUWD[LQJSRZHUVRUDQ\IXQGVRIWKH&LW\WRWKHSD\PHQWRIWKH%RQGV   1RSURYLVLRQFRYHQDQWRUDJUHHPHQWFRQWDLQHGLQWKHDIRUHPHQWLRQHGGRFXPHQWVWKH%RQGVRU LQDQ\RWKHUGRFXPHQWUHODWLQJWRWKH%RQGVDQGQRREOLJDWLRQWKHUHLQRUKHUHLQLPSRVHGXSRQWKH&LW\RU WKH EUHDFK WKHUHRI VKDOO FRQVWLWXWH RU JLYH ULVH WR D JHQHUDOR U P R U D O R E O L J D W L R Q R I W K H & L W \ R U D Q \  SHFXQLDU\OLDELOLW\RIWKH&LW\RUDQ\FKDUJHXSRQLWVJHQHUDOFUHGLWRUWD[LQJSRZHUV,QPDNLQJWKH DJUHHPHQWVSURYLVLRQVFRYHQDQWVDQGUHSUHVHQWDWLRQVVHWIRUWKLQVXFKGRFXPHQWVWKH&LW\KDVQRW REOLJDWHGLWVHOIWRSD\RUUHPLWDQ\IXQGVRUUHYHQXHVRWKHUWKDQIXQGVDQGUHYHQXHVGHULYHGIURPWKH /RDQ$JUHHPHQWZKLFKDUHWREHDSSOLHGWRWKHSD\PHQWRIWKH%RQGVDVSURYLGHGWKHUHLQDQGDVDVVLJQHG WRWKH7UXVWHHXQGHUWKH,QGHQWXUH  $SSURYDO RI +RXVLQJ 3URJUDP &RPSOLDQFH ZLWK &HUWDLQ 5HQWDO DQG 2FFXSDQF\ 5HVWULFWLRQVDVWRWKH3URMHFW7KH+RXVLQJ3URJUDPLVKHUHE\DGRSWHGUDWLILHGDQGDSSURYHGLQDOO UHVSHFWVZLWKRXWDPHQGPHQW7KH&LW\0DQDJHULVKHUHE\DXWKRUL]HGWRGRDOORWKHUWKLQJVDQGWDNHDOO RWKHUDFWLRQVDVPD\EHQHFHVVDU\RUDSSURSULDWHWRFDUU\RXWWKH+RXVLQJ3URJUDPLQDFFRUGDQFHZLWKWKH $FW DQG DQ\ RWKHU DSSOLFDEOH ODZV DQG UHJXODWLRQV 7R HQVXUH FRPSOLDQFH ZLWK FHUWDLQ UHQWDO DQG RFFXSDQF\UHVWULFWLRQVLPSRVHGE\WKH$FWDQG6HFWLRQ G RIWKH&RGHDQGWRHQVXUHFRPSOLDQFHZLWK   Y-6%%5 FHUWDLQUHVWULFWLRQVLPSRVHGE\WKH&LW\WKH3URMHFWZLOOEHVXEMHFWWRD5HJXODWRU\$JUHHPHQWGDWHGDV RIRUDIWHU-DQXDU\ WKH³5HJXODWRU\$JUHHPHQW´ DPRQJWKH&LW\WKH%RUURZHUDQGWKH7UXVWHH  $SSURYDORI)RUPV([HFXWLRQ6XEMHFWWRUHFHLYLQJDOORFDWLRQRIWKHERQGLQJDXWKRULW\ IURP00%WKH&LW\2IILFLDOVDUHKHUHE\DXWKRUL]HGDQGGLUHFWHGWRH[HFXWHDQGGHOLYHUWKH,QGHQWXUHWKH /RDQ$JUHHPHQW%RQGVWKH%RQG3XUFKDVH$JUHHPHQWWKH5HJXODWRU\$JUHHPHQWDQGDQ\FRQVHQWVRU VXFKRWKHUGRFXPHQWVDQGFHUWLILFDWHVDVDUHQHFHVVDU\RUDSSURSULDWHLQFRQQHFWLRQZLWKWKHLVVXDQFH VDOH DQG GHOLYHU\ RI WKH %RQGV LQFOXGLQJ ZLWKRXW OLPLWDWLRQ YDULRXV FHUWLILFDWHV RI WKH &LW\ WKH ,QIRUPDWLRQ 5HWXUQ IRU 7D[([HPSW 3ULYDWH $FWLYLW\ %RQG ,VVXHV )RUP  D OHWWHU SUHSDUHG LQ DFFRUGDQFHZLWK6HFWLRQ P  ' RIWKH&RGHHYLGHQFLQJWKHGHWHUPLQDWLRQRIWKH&LW\DVWKHLVVXHU RIWKH%RQGVEDVHGRQFRQFOXVLRQVRIDWKLUGSDUW\DQDO\VWWKDWWKHDPRXQWRIWD[FUHGLWVWREHDOORFDWHG WRWKH3URMHFWZLOOQRWH[FHHGWKHDPRXQWQHFHVVDU\IRUWKHILQDQFLDOIHDVLELOLW\RIWKH3URMHFWDQGLWV YLDELOLW\DVDTXDOLILHGORZLQFRPHKRXVLQJSURMHFWDFHUWLILFDWHDVWRDUELWUDJHDQGUHEDWHDQGVLPLODU GRFXPHQWV FROOHFWLYHO\WKH³)LQDQFLQJ'RFXPHQWV´   $OORIWKHSURYLVLRQVRIWKH)LQDQFLQJ'RFXPHQWVZKHQH[HFXWHGDQGGHOLYHUHGDVDXWKRUL]HG KHUHLQVKDOOEHGHHPHGWREHDSDUWRIWKLVUHVROXWLRQDVIXOO\DQGWRWKHVDPHH[WHQWDVLILQFRUSRUDWHG YHUEDWLPKHUHLQDQGVKDOOEHLQIXOOIRUFHDQGHIIHFWIURPWKHGDWHRIH[HFXWLRQDQGGHOLYHU\WKHUHRI7KH )LQDQFLQJ'RFXPHQWVVKDOOEHVXEVWDQWLDOO\LQWKHIRUPVFXUUHQWO\RQILOHZLWKWKH&LW\ZKLFKDUHKHUHE\ DSSURYHGZLWKVXFKQHFHVVDU\DQGDSSURSULDWHYDULDWLRQVRPLVVLRQVDQGLQVHUWLRQVDVGRQRWPDWHULDOO\ F K D Q J H W K H V X E V W D Q F H W K H U H R I  D Q G D V W K H & L W \ 2 I I L F L D O V  L Q W K HLU GLVFUHWLRQ VKDOO GHWHUPLQH DQG WKH H[HFXWLRQWKHUHRIE\WKH&LW\2IILFLDOVVKDOOEHFRQFOXVLYHHYLGHQFHRIVXFKGHWHUPLQDWLRQ  %RQG 2SLQLRQ  7KH &LW\ KHUHE\ DXWKRUL]HV .HQQHG\  *UDYHQ &KDUWHUHG DV ERQG FRXQVHOWRSUHSDUHH[HFXWHDQGGHOLYHULWVDSSURYLQJOHJDORSLQLRQVZLWKUHVSHFWWRWKH%RQGV  2IILFLDO 6WDWHPHQW  7KH &LW\ KDV QRW SDUWLFLSDWHG LQ WKH SUHSDUDWLRQ RI WKH 2IILFLDO 6WDWHPHQW UHODWLQJ WR WKH RIIHU DQG VDOH RI WKH %RQGV WKH ³2IILFLDO 6WDWHPHQW´  DQG KDV PDGH QR LQGHSHQGHQWLQYHVWLJDWLRQZLWKUHVSHFWWRWKHLQIRUPDWLRQFRQWDLQHGWKHUHLQLQFOXGLQJWKHDSSHQGLFHV WKHUHWRDQGWKH&LW\DVVXPHVQRUHVSRQVLELOLW\IRUWKHVXIILFLHQF\DFFXUDF\RUFRPSOHWHQHVVRIVXFK LQIRUPDWLRQH[FHSWIRUWKHLQIRUPDWLRQXQGHUWKHFDSWLRQV³7+(,668(5´DQG³12/,7,*$7,21²7KH , V V X H U  ´ 6 X E M H F W W R W K H I R U H J R L Q J  W K H & L W \ K H U H E \ F R Q V H Q W V W R WKH GLVWULEXWLRQ DQG WKH XVH E\ WKH 8QGHUZULWHURIWKH2IILFLDO6WDWHPHQWLQFRQQHFWLRQZLWKWKHRIIHUDQGVDOHRIWKH%RQGV7KH2IILFLDO 6WDWHPHQWLVWKHVROHPDWHULDOFRQVHQWHGWRE\WKH&LW\IRUXVHLQFRQQHFWLRQZLWKWKHRIIHUDQGVDOHRIWKH %RQGV  &RXQFLO $XWKRULW\ 1R 3HUVRQDO /LDELOLW\  ([FHSW DV RWKHUZLVHSURYLGHG LQ WKLV UHVROXWLRQDOOULJKWVSRZHUVDQGSULYLOHJHVFRQIHUUHGDQGGXWLHVDQGOLDELOLWLHVLPSRVHGXSRQWKH&LW\RU WKH &LW\ &RXQFLO E\ WKH SURYLVLRQV RI WKLV UHVROXWLRQ RU RI WKH DIRUHPHQWLRQHG GRFXPHQWV VKDOO EH H[HUFLVHGRUSHUIRUPHGE\WKH&LW\RUE\VXFKPHPEHUVRIWKH&LW\&RXQFLORUVXFKRIILFHUVERDUGERG\ RUDJHQF\WKHUHRIDVPD\EHUHTXLUHGRUDXWKRUL]HGE\ODZWRH[HUFLVHVXFKSRZHUVDQGWRSHUIRUPVXFK GXWLHV   1R FRYHQDQW VWLSXODWLRQ REOLJDWLRQ RU DJUHHPHQW KHUHLQ FRQWDLQHG RU FRQWDLQHG LQ WKH DIRUHPHQWLRQHGGRFXPHQWVVKDOOEHGHHPHGWREHDFRYHQDQWVWLSXODWLRQREOLJDWLRQRUDJUHHPHQWRIDQ\ PHPEHURIWKH&LW\&RXQFLORUDQ\RIILFHUDJHQWRUHPSOR\HHRIWKH&LW\LQWKDWSHUVRQ¶VLQGLYLGXDO FDSDFLW\ DQG QHLWKHU WKH &LW\ &RXQFLO QRU DQ\ RIILFHU RU HPSOR\HH H[HFXWLQJ WKH %RQGV VKDOO EH SHUVRQDOO\OLDEOHRQWKH%RQGVRUEHVXEMHFWWRDQ\SHUVRQDOOLDELOLW\RUDFFRXQWDELOLW\E\UHDVRQRIWKH LVVXDQFHWKHUHRI    Y-6%%5  ([FHSWDVRWKHUZLVHH[SUHVVO\SURYLGHGKHUHLQQRWKLQJLQWKLVUHVROXWLRQRULQWKHDIRUHPHQWLRQHG GRFXPHQWVH[SUHVVHGRULPSOLHGLVLQWHQGHGRUVKDOOEHFRQVWUXHGWRFRQIHUXSRQDQ\SHUVRQRUILUPRU FRUSRUDWLRQRWKHUWKDQWKH&LW\RUDQ\KROGHURIWKH%RQGVLVVXHGXQGHUWKHSURYLVLRQVRIWKLVUHVROXWLRQ DQ\ULJKWUHPHG\RUFODLPOHJDORUHTXLWDEOHXQGHUDQGE\UHDVRQRIWKLVUHVROXWLRQRUDQ\SURYLVLRQV KHUHRIWKLVUHVROXWLRQWKHDIRUHPHQWLRQHGGRFXPHQWVDQGDOORIWKHLUSURYLVLRQVEHLQJLQWHQGHGWREHDQG EHLQJIRUWKHVROHDQGH[FOXVLYHEHQHILWRIWKH&LW\DQGDQ\KROGHUIURPWLPHWRWLPHRIWKH%RQGVLVVXHG XQGHUWKHSURYLVLRQVRIWKLVUHVROXWLRQ  6HYHUDELOLW\,QFDVHDQ\RQHRUPRUHRIWKHSURYLVLRQVRIWKLV5HVROXWLRQRWKHUWKDQWKH SURYLVLRQVFRQWDLQHG6HFWLRQRURIWKHDIRUHPHQWLRQHGGRFXPHQWVRURIWKH%RQGVLVVXHGKHUHXQGHU VKDOOIRUDQ\UHDVRQEHKHOGWREHLOOHJDORULQYDOLGVXFKLOOHJDOLW\RULQYDOLGLW\VKDOOQRWDIIHFWDQ\RWKHU SURYLVLRQRIWKLVUHVROXWLRQRURIWKHDIRUHPHQWLRQHGGRFXPHQWVRURIWKH%RQGVEXWWKLV5HVROXWLRQWKH DIRUHPHQWLRQHGGRFXPHQWVDQGWKH%RQGVVKDOOEHFRQVWUXHGDQGHQGRUVHGDVLIVXFKLOOHJDORULQYDOLG SURYLVLRQVKDGQRWEHHQFRQWDLQHGWKHUHLQ 9DOLGLW\7KH%RQGVZKHQH[HFXWHGDQGGHOLYHUHGVKDOOFRQWDLQDUHFLWDOWKDWWKH\DUH LVVXHGSXUVXDQWWRWKH$FWDQGVXFKUHFLWDOVKDOOEHFRQFOXVLYHHYLGHQFHRIWKHYDOLGLW\RIWKH%RQGVDQG WKHUHJXODULW\RIWKHLVVXDQFHWKHUHRIDQGWKDWDOODFWVFRQGLWLRQVDQGWKLQJVUHTXLUHGE\WKHODZVRIWKH 6WDWHRI0LQQHVRWDUHODWLQJWRWKHDGRSWLRQRIWKLVUHVROXWLRQWRWKHLVVXDQFHRIWKH%RQGVDQGWRWKH H[HFXWLRQRIWKHDIRUHPHQWLRQHGGRFXPHQWVWRKDSSHQH[LVWDQGEHSHUIRUPHGSUHFHGHQWWRWKHH[HFXWLRQ RIWKHDIRUHPHQWLRQHGGRFXPHQWVKDYHKDSSHQHGH[LVWDQGKDYHEHHQSHUIRUPHGDVVRUHTXLUHGE\ODZ $XWKRUL]DWLRQ 'LUHFWLRQ  7KH RIILFHUV RI WKH &LW\ ERQG FRXQVHO RWKHU DWWRUQH\V HQJLQHHUVDQGRWKHUDJHQWVRUHPSOR\HHVRIWKH&LW\DUHKHUHE\DXWKRUL]HGWRGRDOODFWVDQGWKLQJV UHTXLUHGRIWKHPE\RULQFRQQHFWLRQZLWKWKLVUHVROXWLRQWKHDIRUHPHQWLRQHGGRFXPHQWVDQGWKH%RQGV IRUWKHIXOOSXQFWXDODQGFRPSOHWHSHUIRUPDQFHRIDOOWKHWHUPVFRYHQDQWVDQGDJUHHPHQWVFRQWDLQHGLQ WKH %RQGV WKHDIRUHPHQWLRQHG GRFXPHQWV DQG WKLV UHVROXWLRQ , I I R U D Q \ U H D V R Q H L W K H U R I W K H & L W \  2IILFLDOVLVXQDEOHWRH[HFXWHDQGGHOLYHUWKHGRFXPHQWVUHIHUUHGWRLQWKLV5HVROXWLRQVXFKGRFXPHQWV PD\EHH[HFXWHGE\DQ\PHPEHURIWKH&LW\&RXQFLORUDQ\RIILFHURIWKH&LW\GHOHJDWHGWKHGXWLHVRI VXFK&LW\2IILFLDOVZLWKWKHVDPHIRUFHDQGHIIHFWDVLIVXFKGRFXPHQWVZHUHH[HFXWHGDQGGHOLYHUHGE\ VXFK&LW\2IILFLDOV &LW\&RVWV7KH%RUURZHUVKDOOSD\WKH&LW\¶VDGPLQLVWUDWLYHIHHLQFRQQHFWLRQZLWKWKH LVVXDQFHRIWKH%RQGVDVSURYLGHGLQWKH/RDQ$JUHHPHQWDQGSD\RUXSRQGHPDQGUHLPEXUVHWKH&LW\ IRUSD\PHQWRIDQ\DQGDOOFRVWVLQFXUUHGE\WKH&LW\LQFRQQHFWLRQZLWKWKH3URMHFWDQGWKHLVVXDQFHRI WKH%RQGVZKHWKHURUQRWWKH%RQGVDUHLVVXHGLQFOXGLQJDQ\FRVWVIRUDWWRUQH\V¶IHHV7KH%RUURZHU VKDOOLQGHPQLI\WKH&LW\DJDLQVWDOOOLDELOLWLHVORVVHVGDPDJHVFRVWVDQGH[SHQVHV LQFOXGLQJDWWRUQH\¶V IHHVDQGH[SHQVHVLQFXUUHGE\WKH&LW\ DULVLQJZLWKUHVSHFWWRWKH3URMHFWRUWKH%RQGVDVSURYLGHGIRU DQGDJUHHGWRE\WKH%RUURZHULQWKH/RDQ$JUHHPHQW )XWXUH$PHQGPHQWV7KHDXWKRULW\WRDSSURYHH[HFXWHDQGGHOLYHUIXWXUHDPHQGPHQWV WRWKH)LQDQFLQJ'RFXPHQWVKHUHLQDXWKRUL]HGHQWHUHGLQWRE\WKH&LW\LQFRQQHFWLRQZLWKWKHLVVXDQFHRI WKH%RQGVDQGDQ\FRQVHQWVUHTXLUHGXQGHUWKH)LQDQFLQJ'RFXPHQWVLVKHUHE\GHOHJDWHGWRWKH&LW\ 2IILFLDOVXSRQFRQVXOWDWLRQZLWKWKH&LW\¶V%RQG&RXQVHOVXEMHFWWRWKHIROORZLQJFRQGLWLRQV D VXFK DPHQGPHQWVRUFRQVHQWVGRQRWUHTXLUHWKHFRQVHQWRIWKHKROGHURIWKH%RQGVRUVXFKFRQVHQWKDVEHHQ REWDLQHG E VXFKDPHQGPHQWVRUFRQVHQWVWRQRWPDWHULDOO\DGYHUVHO\DIIHFWWKHLQWHUHVWVRIWKH&LW\ F  VXFK DPHQGPHQWV RU FRQVHQWV GR QRW FRQWUDYHQH RU YLRODWH DQ\ SROLF\ RI WKH &LW\ DQG G  VXFK DPHQGPHQWV RU FRQVHQWV DUH DFFHSWDEOH LQ IRUP DQG VXEVWDQFH WRWKH &LW\¶V %RQG &RXQVHO  7KH DXWKRUL]DWLRQKHUHE\JLYHQVKDOOEHIXUWKHUFRQVWUXHGDVDXWKRUL]DWLRQIRUWKHH[HFXWLRQDQGGHOLYHU\RI VXFKFHUWLILFDWHVDQGUHODWHGLWHPVDVPD\EHUHTXLUHGWRGHPRQVWUDWHFRPSOLDQFHZLWKWKHDJUHHPHQWV EHLQJDPHQGHGDQGWKHWHUPVRIWKLV5HVROXWLRQ7KHH[HFXWLRQRIDQ\LQVWUXPHQWE\WKH&LW\2IILFLDOV   Y-6%%5 VKDOOEHFRQFOXVLYHHYLGHQFHRIWKHDSSURYDORIVXFKLQVWUXPHQWVLQDFFRUGDQFHZLWKWKHWHUPVKHUHRI,Q WKHDEVHQFHRIHLWKHURIWKH&LW\2IILFLDOVDQ\LQVWUXPHQWDXWKRUL]HGE\WKLVSDUDJUDSKWREHH[HFXWHGDQG GHOLYHUHGPD\EHH[HFXWHGE\WKHRIILFHURIWKH&LW\RUWKH&LW\DXWKRUL]HGWRDFWLQKLVKHUSODFHDQG VWHDG *RYHUQPHQWDO3URJUDP7KH&LW\KDVHVWDEOLVKHGDJRYHUQPHQWDOSURJUDPRIDFTXLULQJ SXUSRVHLQYHVWPHQWVIRUTXDOLILHGUHVLGHQWLDOUHQWDOSURMHFWV7KHJRYHUQPHQWDOSURJUDPLVRQHLQZKLFK WKHIROORZLQJUHTXLUHPHQWVRI† E RIWKHIHGHUDOUHJXODWLRQVUHODWLQJWRWD[H[HPSWREOLJDWLRQV VKDOOEHPHW D  WKHSURJUDPLQYROYHVWKHRULJLQDWLRQRUDFTXLVLWLRQRISXUSRVHLQYHVWPHQWV E  DWOHDVWRIWKHFRVWRIWKHSXUSRVHLQYHVWPHQWVDFTXLUHGXQGHUWKHSURJUDP UHSUHVHQWVRQHRUPRUHORDQVWRDVXEVWDQWLDOQXPEHURISHUVRQVUHSUHVHQWLQJWKHJHQHUDOSXEOLF VWDWHVRUSROLWLFDOVXEGLYLVLRQV F  RUJDQL]DWLRQVSHUVRQVZKRSURYLGHKRXVLQJDQGUHODWHG IDFLOLWLHVRUDQ\FRPELQDWLRQRIWKHIRUHJRLQJ  F  DW OHDVW  RI WKH UHFHLSWV IURP WKH SXUSRVH LQYHVWPHQWVDUH XVHG WR SD\ SULQFLSDOLQWHUHVWRUUHGHPSWLRQSULFHVRQLVVXHVWKDWILQDQFHGWKHSURJUDPWRSD\RUUHLPEXUVH DGPLQLVWUDWLYHFRVWVRIWKRVHLVVXHVRURIWKHSURJUDPWRSD\RUUHLPEXUVHDQWLFLSDWHGIXWXUH ORVVHVGLUHFWO\UHODWHGWRWKHSURJUDPWRILQDQFHDGGLWLRQDOSXUSRVHLQYHVWPHQWVIRUWKHVDPH JHQHUDOSXUSRVHVRIWKHSURJUDPRUWRUHGHHPDQGUHWLUHJRYHUQPHQWDOREOLJDWLRQVDWWKHQH[W HDUOLHVWSRVVLEOHGDWHRIUHGHPSWLRQ G  WKHSURJUDPGRFXPHQWVSURKLELWDQ\REOLJRURQDSXUSRVHLQYHVWPHQWILQDQFHGE\ WKHSURJUDPRUDQ\UHODWHGSDUW\WRWKDWREOLJRUIURPSXUFKDVLQJ%RQGVRIDQLVVXHWKDWILQDQFHV WKHSURJUDPLQDQDPRXQWUHODWHGWRWKHDPRXQWRIWKHSXUSRVHLQYHVWPHQWDFTXLUHGIURPWKDW REOLJRUDQG  H  WKH&LW\VKDOOQRWZDLYHWKHULJKWWRWUHDWWKHLQYHVWPHQWDVDSURJUDPLQYHVWPHQW (IIHFWLYH 'DWH 7KLV 5HVROXWLRQ VKDOO EH LQ IXOO IRUFH DQG HIIHFW IURP DQG DIWHU LWV DSSURYDO    'HFHPEHU    ' D W H   0 D \ R U    $ 7 7 ( 6 7      &LW\&OHUN   7KH PRWLRQ IRU WKH DGRSWLRQ RI WKH IRUHJRLQJ UHVROXWLRQ ZDV GXO\ VHFRQGHG E\ &RXQFLOPHPEHU BBBBBBBBBBBBBBBBBBBBBBBDQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI    DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH    Y-6%%5  ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG Un i t y ȱ Pl a c e Re n o v a t i o n De c e m b e r ȱ 10 , ȱ 20 1 8 Ab o u t ȱ Co m m u n i t y ȱ Ho u s i n g ȱ De v e l o p m e n t ȱ Co r p o r a t i o n ȱ (C H D C ) Un i t y ȱ Pl a c e ȱ Pr o p e r t y ȱ Ch a r a c t e r i s t i c s ‡ 11 2 Ȭ un i t ȱ re n t a l ȱ to w n h o m e ȱ co m p l e x ȱ co n s i s t i n g ȱ of ȱ 61 ȱ tw o ȱ an d ȱ 51 ȱ th r e e ȱ be d r o o m ȱ un i t s . ‡ Or i g i n a l l y ȱ bu i l t ȱ in ȱ 19 7 8 , ȱ CH D C ȱ ha s ȱ ow n e d ȱ th e ȱ pr o p e r t y ȱ si n c e ȱ 19 9 4 . ‡ Ge n e r a l ȱ oc c u p a n c y ȱ pe r m a n e n t ȱ re n t a l ȱ ho u s i n g ȱ pr i m a r i l y ȱ fo r ȱ lo w ȱ in c o m e ȱ fa m i l i e s . ȱ ‡ 10 0 % ȱ of ȱ th e ȱ un i t s ȱ ha v e ȱ pr o j e c t Ȭ ba s e d ȱ Se c t i o n ȱ 8 ȱ re n t ȱ as s i s t a n c e . Pr o p o s e d ȱ Re f i n a n c e ȱ an d ȱ Re n o v a t i o n ȱ Pu r p o s e ‡ Se c t i o n ȱ 8 ȱ co n t r a c t ȱ re n e w e d ȱ an d ȱ pr e s e r v e d . ‡ Ca p i t a l ȱ an d ȱ li v a b i l i t y ȱ im p r o v e m e n t s , ȱ so ȱ th e ȱ pr o p e r t y ȱ is ȱ so l i d ȱ fo r ȱ th e ȱ ne x t ȱ 20 ȱ ye a r s . ȱ ‡ (N o t ȱ ad d i n g ȱ un i t s ȱ or ȱ mo d i f y i n g ȱ un i t ȱ si z e s ) ȱ Ta x ȱ Ex e m p t ȱ Co n d u i t ȱ Bo n d s ȱ ‡ St a t e ȱ bo n d s ȱ wi t h ȱ a ȱ sm a l l e r ȱ in t e r e s t ȱ ra t e . ‡ Co m e ȱ wi t h ȱ fe d e r a l ȱ lo w ȱ in c o m e ȱ ho u s i n g ȱ ta x ȱ cr e d i t s . Re n o v a t i o n ȱ Ac t i v i t i e s ȱ Ov e r v i e w ‡ Ap p r o x i m a t e l y ȱ $6 7 , 0 0 0 ȱ pe r ȱ un i t . ‡ Re s i d e n t s ȱ oc c u p y ȱ un i t s ȱ du r i n g ȱ co n s t r u c t i o n . ȱ Wo r k i n g ȱ ha r d ȱ to ȱ mi n i m i z e ȱ di s r u p t i o n . ‡ Re p a i r s , ȱ as s e t ȱ pr o t e c t i o n , ȱ su s t a i n a b i l i t y ȱ an d ȱ li v a b i l i t y ȱ im p r o v e m e n t s . Re p a i r s As s e t ȱ Pr o t e c t i o n Su s t a i n a b i l i t y ȱ an d ȱ Bu i l d i n g ȱ Pe r f o r m a n c e Li v a b i l i t y ȱ Im p r o v e m e n t s Li v a b i l i t y ȱ Im p r o v e m e n t s Li v a b i l i t y ȱ Im p r o v e m e n t s ȱ 2) ) , & ( & 2 0 0 8 1 , 7 <  5 2 2 0 ) , 7 1 ( 6 6  5 2 2 0 2) ) , & ( 0( ( 7 , 1 * Qu e s t i o n s ?                   !!" ## $%  &' &"('&) *                      !" #$ %     !" #$&$ %    !" #$ '"   !" #    !"   ! #+*  ,-.&&&)!   #'" #' //&&&))(&"! 0(#" 0(" & ) ( ) ! 1& ' &2#&) *3 !0(" &#' "' "#""##&&#' ""(#)#('&&&""/&2#&&3!-.&&& '&#' ""(,#&)2 "") *")!0))&.((&  &/!'") "!)& # /(2/&""#! ) ! ' &&/&3 ! #&! )'- '&& ) #! ) ! )2 '& "# #("  #!& #&&  / " #&! +'#& "  ! #& # ) ! ' /(2/& &&#" -! ! 1& 45 (' 6/(2/7'8 6793   *#&&((&"):$$-"$/$-'&"/ #&!&2&) "(&()"+&2#")#)& # /(2/&3 &)! 2 & '&#//""&)''-&) *     !"#$  !"#%  & '& !5 &"' 8; '9 <=3>= <434 < 3 ;  & /( ! 5 &"'& 68 5? ''&9 668?5> ''&9 6668>"9 <3== ?3 = =34= <34* ?3 =3  < 34 ''& < 3  ''& < 3@ ''& & /( !5 5&"' 87 ''&9 <?3 = <?3= < 3?  ''& ()(*& !8; '9 < 3= < =3 * <3=@;  & /( ! 87 ''&9 <?3? <?34 < 3> ''& 55&"' (+(*& !8; '9 <=3@@ <43 @ < 3? ;  (&& !8; '9 <>344 <>344 #! )& !8; '9 <3* <3* #!  ! '+'')! &!'" &  ''&)-8#&""!(#'&"' &9&&!- #/(&  &&)''-&   !"#$ !"#% ,&- '<4 34> <>3= <?34 ()(* 3= =3 * 3=@ (+(*=3@@ 43 @ 3? (&>344 >344 5 )3* 3* 5 <@=3 < 3>? <>3?4  $))&'&#//"#&!&"'-/#!84 A?=A/9)/<**3  <=*3 3!&#!&(('"'# &/&-!"#; (2 &'50&&"' -/&()-#& #('#-/"/"''! !! '#)((-3! -''# ('#-/&#!!# &/) ) "+-")#23!#!/&&)#'+'-!#&! ( #!&! -/)<? /(' &#&&&&#"-!&))/"/&('#3  !((&"&- '"+#/))#2%  *3   "&#&3 "3 >; #"!(!   #'&- ' &3!7 +'##-&( +'&!"!.' 7&2/+  3  ! *+ "" '2 (,#&)'#!((&" '&3 (./ $)$# $+' //   0HPEHUBBBBBBBBBBBBBBBBBBBBBBBBBBBBBLQWURGXFHGWKHIROORZLQJUHVROXWLRQ DQGPRYHGLWVDGRSWLRQ   5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21 $'237,1*  :$7(5 87,/,7< 5$7(6 )((6 $1' &+$5*(6  :+(5($6WKH&LW\RI%URRNO\Q&HQWHU&KDUWHUUHTXLUHVWKDWPXQLFLSDOXWLOLWLHV EHVHOIVXSSRUWLQJWKURXJKUHYHQXHSURYLGHGE\DXQLIRUPVFKHGXOHRIUDWHVIHHVDQGFKDUJHV DQG :+(5($6 WKLV XQLIRUP VFKHGXOH VKDOO EH FDOOHG WKH ³3XEOLF 8WLOLW\ 5DWH 6FKHGXOH´DQGVKDOOEHDGRSWHGE\UHVROXWLRQRIWKH&LW\&RXQFLODQG  :+(5($6ILQDQFLDOUHTXLUHPHQWVIRUWKHXWLOLW\IXQGVKDYHEHHQLGHQWLILHGDQG UHYLHZHGE\WKH&LW\&RXQFLO  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHUWKDWWKHIROORZLQJ:DWHU8WLOLW\UDWHVIHHVDQGFKDUJHVDUHKHUHE\DGRSWHGDQG VKDOOEHHIIHFWLYHIRUDOOELOOLQJVLVVXHGRQRUDIWHU-DQXDU\  :$7(587,/,7<5$7(6&+('8/( :DWHU5DWHV)HHVDQG&KDUJHV  %DVH5DWH <HDU SHU*DOORQV  4XDUWHUO\0LQLPXP5DWH 0HWHU6L]H4XDUWHUO\0LQLPXP&KDUJH ´  ò  ´  ´  ´  ´  ´  ´   :DWHU&RQVHUYDWLRQ5DWH  0HWHU6L]H%DVH&KDUJH PLQLPXPFKDUJHSHUTXDUWHU  ´DQG´   7KRXVDQGVRI*DOORQV&RQVXPSWLRQ&KDUJH SHUJDOORQVXVHG  WR  WR  DQGJUHDWHU   5(62/87,2112BBBBBBBBBBBBBB     )HHV  :DWHU0HWHU&KDUJH´RU´   :DWHU0HWHU&KDUJH/DUJHUWKDQ´  $FWXDO&RVW  2WKHU&KDUJHV  'HOLQTXHQWDFFRXQWTXDUWHUO\FKDUJH  *UHDWHURIRURIXQSDLGEDODQFH &HUWLILFDWLRQIRUFROOHFWLRQZLWKSURSHUW\WD[HV     ) L U H  6 H U Y L F H  / L Q H  & K D U J H    SHUTXDUWHU     'HFHPEHU     'DWH 0D\RU   $77(67       &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG 0HPEHU BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB LQWURGXFHG WKH IROORZLQJ UHVROXWLRQDQGPRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21 $'237,1*  6(:(5 87,/,7< 5$7(6 )((6 $1' &+$5*(6  :+(5($6WKH&LW\RI%URRNO\Q&HQWHU&KDUWHUUHTXLUHVWKDWPXQLFLSDOXWLOLWLHV EHVHOIVXSSRUWLQJWKURXJKUHYHQXHSURYLGHGE\DXQLIRUPVFKHGXOHRIUDWHVIHHVDQGFKDUJHV DQG  :+(5($6 WKLV XQLIRUP VFKHGXOH VKDOO EH FDOOHG WKH ³3XEOLF 8WLOLW\ 5DWH 6FKHGXOH´DQGVKDOOEHDGRSWHGE\UHVROXWLRQRIWKH&LW\&RXQFLODQG  :+(5($6ILQDQFLDOUHTXLUHPHQWVIRUWKHXWLOLW\IXQGVKDYHEHHQLGHQWLILHGDQG UHYLHZHGE\WKH&LW\&RXQFLO  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHUWKDWWKHIROORZLQJ6HZHU8WLOLW\UDWHVIHHVDQGFKDUJHVDUHKHUHE\DGRSWHGDQG VKDOOEHHIIHFWLYHIRUDOOELOOLQJVLVVXHGRQRUDIWHU-DQXDU\  6(:(587,/,7<5$7(6&+('8/( 6HZHU5DWHV)HHVDQG&KDUJHV  %DVH5DWH4XDUWHUO\5HVLGHQWLDO PLQLPXPTXDUWHUO\FKDUJH  6LQJOH)DPLO\ $SDUWPHQW 6HQLRU&LWL]HQ <HDU       1RQ5HVLGHQWLDO5DWH <HDU   SHU*DOORQV  )HHV 6$&&KDUJHVHWE\0&(6 )HH(VWDEOLVKHGE\0&(6  &KDUJHV 'HOLQTXHQWDFFRXQWTXDUWHUO\FKDUJH  *UHDWHURIRURIXQSDLGEDODQFH &HUWLILFDWLRQIRUFROOHFWLRQZLWKSURSHUW\WD[HV   /LQHFOHDQLQJFKDUJH /DERUPDWHULDOVHTXLSPHQWDQGRYHUKHDG  6DQLWDU\6HZHU&RQQHFWLRQ (VWDEOLVKHGDQQXDOO\E\UHVROXWLRQ     'HFHPEHU      'DWH 0D\RU  $77(67        &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH  ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG 0HPEHU BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB LQWURGXFHG WKH IROORZLQJ UHVROXWLRQDQGPRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21$'237,1*672506(:(587,/,7<5$7(6)((6 $1'&+$5*(6  :+(5($6WKH&LW\RI%URRNO\Q&HQWHU&KDUWHUUHTXLUHVWKDWPXQLFLSDOXWLOLWLHV EHVHOIVXSSRUWLQJWKURXJKUHYHQXHSURYLGHGE\DXQLIRUPVFKHGXOHRIUDWHVIHHVDQGFKDUJHV DQG  :+(5($6 WKLV XQLIRUP VFKHGXOH VKDOO EH FDOOHG WKH ³3XEOLF 8WLOLW\ 5DWH 6FKHGXOH´DQGVKDOOEHDGRSWHGE\UHVROXWLRQRIWKH&LW\&RXQFLODQG  :+(5($6ILQDQFLDOUHTXLUHPHQWVIRUWKHXWLOLW\IXQGVKDYHEHHQLGHQWLILHGDQG UHYLHZHGE\WKH&LW\&RXQFLO  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHUWKDWWKHIROORZLQJ6WRUP6HZHU8WLOLW\UDWHVDQGFKDUJHVDUHKHUHE\FRQWLQXHG DQGVKDOOEHHIIHFWLYHIRUDOOELOOLQJVLVVXHGRQRUDIWHU-DQXDU\  672506(:(587,/,7<5$7(6&+('8/( 6WRUP6HZHU5DWHVDQG&KDUJHV  4XDUWHUO\5DWHVSHU$FUH  0LQLPXP4XDUWHUO\&KDUJH %DVH5DWH  &HPHWHULHVDQG*ROI&RXUVHV  3DUNV  6LQJOH)DPLO\'XSOH[7RZQKRXVH ORW 6FKRRO*RYHUQPHQW%XLOGLQJV  0XOWLSOH)DPLO\&KXUFKHV  &RPPHUFLDO,QGXVWULDO  9DFDQW/DQG $V$VVLJQHG  &KDUJHV 'HOLQTXHQWDFFRXQWTXDUWHUO\FKDUJH  *UHDWHURIRURIXQSDLGEDODQFH &HUWLILFDWLRQIRUFROOHFWLRQZLWKSURSHUW\WD[HV   3ULYDWHIDFLOLW\FOHDQLQJFKDUJH /DERUPDWHULDOVHTXLSPHQWDQGRYHUKHDG     'HFHPEHU    ' D W H     0 D \ R U   $77(67       &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG 0HPEHU    LQWURGXFHGWKHIROORZLQJ UHVROXWLRQDQGPRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21$'237,1*675((7/,*+75$7(6$1'&+$5*(6  :+(5($6WKH&LW\RI%URRNO\Q&HQWHU&KDUWHUUHTXLUHVWKDWPXQLFLSDOXWLOLWLHV EHVHOIVXSSRUWLQJWKURXJKUHYHQXHSURYLGHGE\DXQLIRUPVFKHGXOHRIUDWHVIHHVDQGFKDUJHV DQG  :+(5($6 WKLV XQLIRUP VFKHGXOH VKDOO EH FDOOHG WKH ³3XEOLF 8WLOLW\ 5DWH 6FKHGXOH´DQGVKDOOEHDGRSWHGE\UHVROXWLRQRIWKH&LW\&RXQFLODQG  :+(5($6ILQDQFLDOUHTXLUHPHQWVIRUWKHXWLOLW\IXQGVKDYHEHHQLGHQWLILHGDQG UHYLHZHGE\WKH&LW\&RXQFLO  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHUWKDWWKHIROORZLQJ6WUHHW/LJKW8WLOLW\UDWHVDQGFKDUJHVDUHKHUHE\DGRSWHGDQG VKDOOEHHIIHFWLYHIRUDOOELOOLQJVLVVXHGRQRUDIWHU-DQXDU\  675((7/,*+787,/,7<5$7(6&+('8/( 6WUHHW/LJKW5DWHVDQG&KDUJHV 4XDUWHUO\5DWHV  &XVWRPHU0LQLPXP4XDUWHUO\&KDUJH 3HU'ZHOOLQJ8QLW 6LQJOH'RXEOHDQG0XOWLSOH)DPLO\ 5HVLGHQWLDO   3HU$FUH 3DUNV  6FKRROV*RYHUQPHQW%XLOGLQJV&KXUFKHV  5HWDLODQG6HUYLFH2IILFH  &RPPHUFLDODQG,QGXVWULDO  9DFDQW/DQGDQG2SHQ6SDFH $V$VVLJQHG  &KDUJHV 'HOLQTXHQWDFFRXQWTXDUWHUO\FKDUJH  *UHDWHURIRURIXQSDLGEDODQFH &HUWLILFDWLRQIRUFROOHFWLRQZLWKSURSHUW\WD[HV       'HFHPEHU      'DWH 0D\RU  $77(67        &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU   DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG 0HPEHU    LQWURGXFHG WKH IROORZLQJ UHVROXWLRQDQGPRYHGLWVDGRSWLRQ  5(62/87,2112BBBBBBBBBBBBBBB  5(62/87,21(67$%/,6+,1*5(&<&/,1*5$7(6$1'&+$5*(6  :+(5($6WKH&LW\RI%URRNO\Q&HQWHULVDPHPEHURIWKH+HQQHSLQ5HF\FOLQJ *URXS +5* ZKLFKLVDMRLQWSRZHUVJURXSRUJDQL]HGSXUVXDQWWR0LQQHVRWD6WDWXWHV6HFWLRQ   DQG  :+(5($6 WKH SXUSRVH RI WKH MRLQW SRZHUV DJUHHPHQW LV WR FUHDWHD Q  RUJDQL]DWLRQE\ZKLFKPHPEHUFLWLHVPD\MRLQWO\DQGFRRSHUDWLYHO\SURYLGHIRUWKHHIILFLHQWDQG HFRQRPLFDOFROOHFWLRQUHF\FOLQJDQGGLVSRVDORIVROLGZDVWHZLWKLQDQGZLWKRXWWKHLUUHVSHFWLYH FRUSRUDWH ERXQGDULHV LQ FRPSOLDQFH ZLWK WKH 0LQQHVRWD :DVWH 0DQDJHPHQW $FW 0LQQHVRWD 6WDWXWHV&KDSWHU$  DQG  :+(5($6 WKH +5* KDV HVWDEOLVKHG D FXUEVLGH UHF\FOLQJ SURJUDP IRU LWV PHPEHUFLWLHVWRPHHWWKHUHTXLUHPHQWVRI+HQQHSLQ&RXQW\2UGLQDQFH1R6ROLG:DVWH 6RXUFH6HSDUDWLRQIRU+HQQHSLQ&RXQW\DQG    :+(5($6WKH&LW\RI%URRNO\Q&HQWHUPXVWHVWDEOLVKUDWHVWRIXQGWKH&LW\¶V FXUEVLGHUHF\FOLQJSURJUDPDQGWKHFRVWIRUSURMHFWHGUHLPEXUVHPHQWRIUHF\FOLQJFKDUJHVIURP WKH+5*DORQJZLWKRWKHUSURJUDPRSHUDWLQJFKDUJHVDQG  :+(5($6WKHUHF\FOLQJSURJUDPLQFOXGHVDELDQQXDOFXUEVLGHFOHDQXSDQG    :+(5($6%URRNO\Q&HQWHU2UGLQDQFH1RDXWKRUL]HVWKH&LW\WR HVWDEOLVKUDWHVIRUUHF\FOLQJVHUYLFHV  12:7+(5()25(%(,75(62/9('E\WKH&LW\&RXQFLORIWKH&LW\RI %URRNO\Q&HQWHUWKDWWKHUHF\FOLQJFKDUJHVVKDOOEHDVIROORZVIRUDOOELOOLQJVLVVXHGRQRUDIWHU -DQXDU\  5(&<&/,1*87,/,7<5$7(6&+('8/( 5HF\FOLQJ5DWHVDQG&KDUJHV  0LQLPXP&KDUJHSHU+RXVHKROGSHUTXDUWHU   SHUTXDUWHU  &KDUJHV  'HOLQTXHQWDFFRXQWTXDUWHUO\FKDUJH  *UHDWHURIRURIXQSDLGEDODQFH &HUWLILFDWLRQIRUFROOHFWLRQZLWKSURSHUW\WD[HV         'HFHPEHU      'DWH 0D\RU   $77(67        &LW\&OHUN  7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\PHPEHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG &ŝ Ŷ Ă Ŷ Đ Ğ   Ğ Ɖ Ă ƌ ƚ ŵ Ğ Ŷ ƚ Ğ Đ Ğ ŵ ď Ğ ƌ  ϭ Ϭ ͕  Ϯ Ϭ ϭ ϴ  DĂ ŝ Ŷ ƚ Ă ŝ Ŷ  Ɛ Ğ ƌ ǀ ŝ Đ Ğ  ů Ğ ǀ Ğ ů Ɛ ^ƚ Ă ď ŝ ů ŝ nj Ğ  ƌ Ă ƚ Ğ  Đ Ś Ă Ŷ Ő Ğ Ɛ Wƌ Ž ǀ ŝ Ě Ğ  Đ Ă Ɛ Ś  Ĩ Ž ƌ  Ž Ɖ Ğ ƌ Ă ƚ ŝ Ŷ Ő  Ŷ Ğ Ğ Ě Ɛ Wƌ Ž ǀ ŝ Ě Ğ  Đ Ă Ɛ Ś  Ĩ Ž ƌ  Đ Ă Ɖ ŝ ƚ Ă ů  Ɖ ƌ Ž ũ Ğ Đ ƚ Ɛ Wƌ Ž ǀ ŝ Ě Ğ  Đ Ă Ɛ Ś  Ĩ Ž ƌ  Ě Ğ ď ƚ  Ɛ Ğ ƌ ǀ ŝ Đ Ğ  ZĂ ƚ Ğ Ɛ  Ɖ ƌ ŝ ŵ Ă ƌ ŝ ů LJ  Ě ƌ ŝ ǀ Ğ  ď LJ  Ψ ϭ ϵ ͘ Ϯ  ŵ ŝ ů ů ŝ Ž Ŷ  ŝ Ŷ  Ƶ ƚ ŝ ů ŝ ƚ LJ  ŝ Ŷ Ĩ ƌ Ă Ɛ ƚ ƌ Ƶ Đ ƚ Ƶ ƌ Ğ ŝŶ ǀ Ğ Ɛ ƚ ŵ Ğ Ŷ ƚ Ɛ  Ž ǀ Ğ ƌ  Ŷ Ğ dž ƚ  ƚ ǁ Ž  LJ Ğ Ă ƌ Ɛ  6 W R U P  ' U D L Q D J H 6 D Q L W D U \  6 H Z H U : D W H U 6 W U H H W  / L J K W 3U R M H F W 8W L O L W \ 8 W L O L W \ 8 W L O L W \ 8 W L O L W \    ,Q W H U V W D W H  $ U H D  , P S U R Y H P H Q W V                                     % H O O Y X H  $ U H D  0 L O O  D Q G  2 Y H U O D \                         6 R X W K H D V W  $ U H D  0 L O O  D Q G  2 Y H U O D \                          %U R R N O \ Q  % R X O H Y D U G  & R U U L G R U  3 U R M H F W    W K  $ Y H   W R  % D V V  / N  5 G                                V W  $ Y H Q X H  , P S U R Y H P H Q W V  D W  % U R R N O \ Q  % O Y G                        &R Q Q H F W L R Q V  D W  6 K L Q J O H  & U H H N  3 K D V H    & U H H N  6 W D E L O L ] D W L R Q  3 U R M H              W K  $ Y H Q X H  6 W R U P  6 H Z H U  7 U X Q N  / L Q H  5 H K D E L O L W D W L R Q               6 W R U P  : D W H U  3 R Q G V                               5 H K D E              /L I W  6 W D W L R Q  1 R     5 H K D E L O L W D W L R Q  D Q G  0 L V V   5 L Y H U  7 U X Q N  6 H Z H U  / LQ L Q              : H O O  1 R V     D Q G    5 H K D E L O L W D W L R Q                    6 X E W R W D O                                         * U D Q G Y L H Z  3 D U N  $ U H D  , P S U R Y H P H Q W V                                      +X P E R O G W  $ Y H  & 5     5 H F R Q V W U X F W L R Q    U G  W R    W K                               /R J D Q  / L O D F    W K  $ Y H Q X H V  5 H F R Q V W U X F W L R Q                              /L I W  6 W D W L R Q  1 R     5 H K D E L O L W D W L R Q               : D W H U  7 R Z H U  1 R      3 D L Q W L Q J               : H O O  1 R     5 H K D E L O L W D W L R Q               6 W R U P  : D W H U  3 R Q G         5 H K D E                   6 X E W R W D O                                      &Ƶ Ŷ Ě  Ğ Ɛ Đ ƌ ŝ Ɖ ƚ ŝ Ž Ŷ Ϯ Ϭ ϭ ϴ  Z Ă ƚ Ğ Ϯ Ϭ ϭ ϵ  Z Ă ƚ Ğ  Ś Ă Ŷ Ő Ğ tĂ ƚ Ğ ƌ Ă Ɛ Ğ   Ś Ă ƌ Ő Ğ ;W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ϳ Ψϭ ϰ ͘ ϲ ϰ Ψ ϭ ϱ ͘ ϱ Ϯ Ψ Ϭ ͘ ϴ ϴ ͬ  Ƌ Ƶ Ă ƌ ƚ Ğ ƌ &R Q V X P S W L R Q  & K D U J H ± 5 H V L G H Q W L D O  0 H W H U V 7L H U  ,    ±    J D O O R Q V 7L H U  , ,     ±    J D O O R Q V 7L H U , , ,     D Q G  J U H D W H U                                  J D O O R Q V              J D O O R Q V               J D O O R Q V Ž Ŷ Ɛ Ƶ ŵ Ɖ ƚ ŝ Ž Ŷ   Ś Ă ƌ Ő Ğ  Ͳ E Ž Ŷ Ͳ ƌ Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů ;W Ğ ƌ  ϭ ͕ Ϭ Ϭ Ϭ  Ő Ă ů ů Ž Ŷ Ɛ Ϳ Ψ ϯ ͘ Ϭ ϰ Ψ ϯ ͘ ϰ Ϯ Ψ Ϭ ͘ ϯ ϴ ͬ  ϭ ͕ Ϭ Ϭ Ϭ  Ő Ă ů ů Ž Ŷ Ɛ ^Ă Ŷ ŝ ƚ Ă ƌ LJ  ^ Ğ ǁ Ğ ƌ Ă Ɛ Ğ   Ś Ă ƌ Ő Ğ ;W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ϳ Ψϴ Ϯ ͘ ϰ Ϯ Ψ ϴ ϰ ͘ ϴ ϵ Ψ Ϯ ͘ ϰ ϳ ͬ  Ƌ Ƶ Ă ƌ ƚ Ğ ƌ Ž Ŷ Ɛ Ƶ ŵ Ɖ ƚ ŝ Ž Ŷ   Ś Ă ƌ Ő Ğ  Ͳ E Ž Ŷ Ͳ ƌ Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů ;W Ğ ƌ  ϭ ͕ Ϭ Ϭ Ϭ  Ő Ă ů ů Ž Ŷ Ɛ Ϳ Ψ ϯ ͘ ϯ Ϯ Ψ ϯ ͘ ϱ ϴ Ψ Ϭ ͘ Ϯ ϲ ͬ  ϭ ͕ Ϭ Ϭ Ϭ  Ő Ă ů ů Ž Ŷ Ɛ ^ƚ Ž ƌ ŵ  ^ Ğ ǁ Ğ ƌ Ă Ɛ Ğ   Ś Ă ƌ Ő Ğ ;W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ϳ Ψϭ ϰ ͘ ϳ ϳ Ψ ϭ ϱ ͘ Ϭ ϲ Ψ Ϭ ͘ ϯ Ϭ  ͬ Ƌ Ƶ Ă ƌ ƚ Ğ ƌ ^ƚ ƌ Ğ Ğ ƚ  > ŝ Ő Ś ƚ Ă Ɛ Ğ   Ś Ă ƌ Ő Ğ ;W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ϳ Ψϲ ͘ ϱ ϱ Ψ ϲ ͘ ϱ ϱ E Ž  Đ Ś Ă Ŷ Ő Ğ ZĞ Đ LJ Đ ů ŝ Ŷ Ő Ă Ɛ Ğ   Ś Ă ƌ Ő Ğ ;W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ϳ Ψϭ ϭ ͘ ϵ ϴ Ψ ϭ ϭ ͘ ϵ ϴ E Ž  Đ Ś Ă Ŷ Ő Ğ  Ƶ ƌ ƌ Ğ Ŷ ƚ ͗   Ψ ϵ ϵ  t Ă ƚ Ğ ƌ  D Ğ ƚ Ğ ƌ   Ś Ă ƌ Ő Ğ  ; Z Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů Ϳ ͬ  Đ ƚ Ƶ Ă ů   Ž Ɛ ƚ  н  Ψ Ϯ  ; E Ž Ŷ Ͳ ƌ Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů Ϳ KŶ ů LJ  Đ Ś Ă ƌ Ő Ğ Ě  ǁ Ś Ğ Ŷ  Ă  Đ Ƶ Ɛ ƚ Ž ŵ Ğ ƌ  Ž ď ƚ Ă ŝ Ŷ Ɛ  Ă  Ŷ Ğ ǁ  ǁ Ă ƚ Ğ ƌ  ŵ Ğ ƚ Ğ ƌ  ; Ŷ Ğ ǁ  ĐŽ Ŷ Ɛ ƚ ƌ Ƶ Đ ƚ ŝ Ž Ŷ  Ž ƌ  ƌ Ğ Ɖ ů Ă Đ Ğ ŵ Ğ Ŷ ƚ  Ž Ĩ  Ă  Ě Ă ŵ Ă Ő Ğ Ě  ŵ Ğ ƚ Ğ ƌ  Ă Ɛ  Ă  ƌ Ğ Ɛ Ƶ ů ƚ  Ž Ĩ  ŝŶ ƚ Ğ Ŷ ƚ ŝ Ž Ŷ Ă ů  Ě Ă ŵ Ă Ő Ğ ͬ Ŷ Ğ Ő ů ŝ Ő Ğ Ŷ Đ Ğ Ϳ EŽ ƚ  Đ Ś Ă ƌ Ő Ğ Ě  Ĩ Ž ƌ  ǁ Ž ƌ Ŷ ͬ Ě Ğ Ĩ Ğ Đ ƚ ŝ ǀ Ğ  ǁ Ă ƚ Ğ ƌ  ŵ Ğ ƚ Ğ ƌ Ɛ Wƌ Ž Ɖ Ž Ɛ Ğ Ě ͗   Ψϭ ϰ ϵ  tĂ ƚ Ğ ƌ  D Ğ ƚ Ğ ƌ   Ś Ă ƌ Ő Ğ  ; Z Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů Ϳ ͬ   Đ ƚ Ƶ Ă ů  Ž Ɛ ƚ  н  Ψ Ϯ  ; E Ž Ŷ Ͳ ƌ Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů Ϳ Đ ƚ Ƶ Ă ů  Đ Ž Ɛ ƚ  ƚ Ž  ƚ Ś Ğ   ŝ ƚ LJ  Ž Ĩ  Ψ Ϯ ϯ Ϭ ͬ ŵ Ğ ƚ Ğ ƌ  н  Đ Ž Ɛ ƚ Ɛ  Ă Ɛ Ɛ Ž Đ ŝ Ă ƚ Ğ Ě  ǁ ŝ ƚ Ś  Ɛƚ Ă Ĩ Ĩ  ƚ ŝ ŵ Ğ  ƚ Ž  Ă Ě ŵ ŝ Ŷ ŝ Ɛ ƚ Ğ ƌ  Ă Ŷ Ě  ƌ Ğ Ɖ ů Ă Đ Ğ   &Ƶ Ŷ Ě Ϯ Ϭ ϭ ϴ  ŝ ů ů  Ϯ Ϭ ϭ ϵ   ŝ ů ů Ψ   Ś Ă Ŷ Ő Ğ ͬ Ƌ Ƶ Ă ƌ ƚ Ğ ƌ tĂ ƚ Ğ ƌ Ψϱ ϴ ͘ ϱ ϲ Ψ ϲ Ϯ ͘ ϭ ϰ Ψ ϯ ͘ ϱ ϴ ^Ă Ŷ ŝ ƚ Ă ƌ LJ  ^ Ğ ǁ Ğ ƌ Ψϴ Ϯ ͘ ϰ Ϯ             Ψ ϴ ϰ ͘ ϴ ϵ Ϯ ͘ ϰ ϳ ^ƚ Ž ƌ ŵ  ^ Ğ ǁ Ğ ƌ Ψϭ ϰ ͘ ϳ ϳ Ψ ϭ ϱ ͘ Ϭ ϳ Ϭ ͘ ϯ Ϭ ^ƚ ƌ Ğ Ğ ƚ  > ŝ Ő Ś ƚ Ψϲ ͘ ϱ ϱ Ψ ϲ ͘ ϱ ϱ Ͳ ZĞ Đ LJ Đ ů ŝ Ŷ Ő Ψϭ ϭ ͘ ϵ ϴ Ψϭ ϭ ͘ ϵ ϴ Ͳ dŽ ƚ Ă ů Ψϭ ϳ ϰ ͘ Ϯ ϴ Ψ ϭ ϴ Ϭ ͘ ϲ ϯ Ψ ϲ ͘ ϯ ϱ  Ψ Ͳ Ψ Ϯ Ϭ ͘ Ϭ Ϭ Ψ ϰ Ϭ ͘ Ϭ Ϭ Ψ ϲ Ϭ ͘ Ϭ Ϭ Ψ ϴ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϯ Ϭ ͘ Ϭ Ϭ Ψ ϭ ϰ Ϭ ͘ Ϭ Ϭ Ψϯ ϵ ͘ ϱ Ϭ  Ψϱ ϴ ͘ ϱ ϲ  Ψϲ Ϯ ͘ Ϭ ϳ  Ψϲ Ϯ ͘ ϵ ϰ  Ψϲ ϴ ͘ Ϭ ϰ  Ψϳ ϳ ͘ ϲ ϱ  Ψϵ Ϭ ͘ ϱ ϴ  Ψϵ ϲ ͘ ϯ Ϭ  Ψϭ Ϭ ϴ ͘ ϵ ϵ  Ψϭ Ϭ ϵ ͘ ϱ ϵ  Ψϭ Ϯ ϰ ͘ ϳ ϭ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů   Ž Ɛ ƚ  Ž Ĩ  ϭ ϴ ͕ Ϭ Ϭ Ϭ  ' Ă ů ů Ž Ŷ Ɛ  Ž Ĩ  t Ă ƚ Ğ ƌ  Ɖ Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ   Ĩ Ž ƌ  Ϯ Ϭ ϭϴ  Ψ Ͳ Ψ Ϯ Ϭ ͘ Ϭ Ϭ Ψ ϰ Ϭ ͘ Ϭ Ϭ Ψ ϲ Ϭ ͘ Ϭ Ϭ Ψ ϴ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϯ Ϭ ͘ Ϭ Ϭ Ψϲ ϭ ͘ Ϯ Ϯ  Ψϳ Ϯ ͘ ϭ ϵ  Ψϳ ϯ ͘ Ϭ Ϯ  Ψϳ ϴ ͘ Ϭ ϱ  Ψϴ Ϯ ͘ ϰ Ϯ  Ψϴ ϰ ͘ ϴ ϵ  Ψϵ Ϯ ͘ ϭ ϲ  Ψϵ Ϯ ͘ ϵ ϵ  Ψϵ ϰ ͘ ϵ ϱ  Ψϭ Ϭ ϳ ͘ Ϭ Ϭ  Ψϭ ϭ ϯ ͘ ϭ ϭ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů   Ž Ɛ ƚ  Ž Ĩ  ϭ ϴ ͕ Ϭ Ϭ Ϭ  ' Ă ů ů Ž Ŷ Ɛ  Ž Ĩ  ^ Ă Ŷ ŝ ƚ Ă ƌ LJ  ^ Ğ ǁ Ğ ƌ  Ɖ Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ  Ĩ Ž ƌ  Ϯ Ϭ ϭ ϴ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů  h Ɛ Ğ ƌ  ʹ W Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ Ψ Ͳ Ψ ϱ ͘ Ϭ Ϭ Ψ ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ ϱ ͘ Ϭ Ϭ Ψ Ϯ Ϭ ͘ Ϭ Ϭ Ψ Ϯ ϱ ͘ Ϭ Ϭ Ψ ϯ Ϭ ͘ Ϭ Ϭ &ƌ ŝ Ě ů Ğ LJ Z Ž Ɛ Ğ ǀ ŝ ů ů Ğ  ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ ϮϬ ϭ ϴ ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ ϮϬ ϭ ϵ Zŝ Đ Ś Ĩ ŝ Ğ ů Ě  ƌ LJ Ɛ ƚ Ă ů E Ğ ǁ  , Ž Ɖ Ğ ' Ž ů Ě Ğ Ŷ sĂ ů ů Ğ LJ DĂ Ɖ ů Ğ ǁ Ž Ž Ě ^ Ś Ž ƌ Ğ ǀ ŝ Ğ ǁ Ψϵ ͘ Ϯ ϰ  Ψϭ ϯ ͘ ϯ ϱ  Ψϭ ϰ ͘ ϳ ϳ  Ψϭ ϱ ͘ Ϭ ϳ  Ψϭ ϳ ͘ ϳ ϴ  Ψϭ ϴ ͘ ϭ ϱ  ΨϮ ϭ ͘ ϲ ϲ  ΨϮ Ϯ ͘ Ϭ Ϭ  ΨϮ ϲ ͘ Ϯ ϱ  ΨϮ ϵ ͘ ϳ Ϯ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů  ^ ƚ Ž ƌ ŵ  t Ă ƚ Ğ ƌ   Ś Ă ƌ Ő Ğ  Ɖ Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ  Ĩ Ž ƌ  Ϯ Ϭ ϭ ϴ  Ψ Ͳ Ψ ϱ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ ϱ Ϭ ͘ Ϭ Ϭ Ψ Ϯ Ϭ Ϭ ͘ Ϭ Ϭ Ψ Ϯ ϱ Ϭ ͘ Ϭ Ϭ Ψ ϯ Ϭ Ϭ ͘ Ϭ Ϭ Ψϭ ϯ ϰ ͘ ϰ ϱ  Ψϭ ϱ ϱ ͘ ϳ ϱ  Ψϭ ϲ Ϯ ͘ Ϭ Ϯ  Ψϭ ϳ ϵ ͘ ϭ ϴ  Ψϭ ϴ ϳ ͘ ϱ ϵ  Ψϭ ϴ ϳ ͘ ϳ Ϭ  Ψϭ ϴ ϴ ͘ ϯ ϲ  Ψϭ ϴ ϵ ͘ Ϭ Ϯ  Ψϭ ϵ Ϭ ͘ ϳ ϱ  ΨϮ Ϭ ϰ ͘ ϲ ϭ  ΨϮ ϱ ϵ ͘ ϰ ϴ  ϮϬ ϭ ϴ  Z Ğ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů  Y Ƶ Ă ƌ ƚ Ğ ƌ ů LJ  ƚ Ž ƚ Ă ů  t Ă ƚ Ğ ƌ ͕  ^ Ğ ǁ Ğ ƌ ͕  Ă Ŷ Ě  ^ ƚ Ž ƌ ŵ  h ƚ ŝ ů ŝ ƚ LJ  ŝ ů ů  ; ϭ ϴ ͕ Ϭ Ϭ Ϭ  Ő Ă ů ů Ž Ŷ Ɛ Ϳ  Ψ Ͳ Ψ Ϯ ͘ Ϭ Ϭ Ψ ϰ ͘ Ϭ Ϭ Ψ ϲ ͘ Ϭ Ϭ Ψ ϴ ͘ Ϭ Ϭ Ψ ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϯ ͘ Ϭ Ϭ Ψ ϭ ϰ ͘ Ϭ Ϭ EĞ ǁ  , Ž Ɖ Ğ  ƌ LJ Ɛ ƚ Ă ů Z ŝ Đ Ś Ĩ ŝ Ğ ů Ě  ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ  Ϯ Ϭ ϭ ϴ ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ  Ϯ Ϭ ϭ ϵ 'Ž ů Ě Ğ Ŷ  s Ă ů ů Ğ LJ ^ Ś Ž ƌ Ğ ǀ ŝ Ğ ǁ Ψϰ ͘ ϵ Ϯ  Ψϱ ͘ Ϭ Ϭ  Ψϱ ͘ ϳ ϳ  Ψϲ ͘ ϱ ϱ  Ψ ϲ ͘ ϱ ϱ  Ψϳ ͘ Ϭ ϱ  Ψϭ ϯ ͘ Ϯ ϯ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů  ^ ƚ ƌ Ğ Ğ ƚ  > ŝ Ő Ś ƚ   Ś Ă ƌ Ő Ğ  Ɖ Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ  Ĩ Ž ƌ  Ϯ Ϭ ϭ ϴ  Ψ Ͳ Ψ Ϯ ͘ Ϭ Ϭ Ψ ϰ ͘ Ϭ Ϭ Ψ ϲ ͘ Ϭ Ϭ Ψ ϴ ͘ Ϭ Ϭ Ψ ϭ Ϭ ͘ Ϭ Ϭ Ψ ϭ Ϯ ͘ Ϭ Ϭ Ψ ϭ ϰ ͘ Ϭ Ϭ ZŽ Ɛ Ğ ǀ ŝ ů ů Ğ & ƌ ŝ Ě ů Ğ LJ D Ă Ɖ ů Ğ ǁ Ž Ž Ě  ƌ LJ Ɛ ƚ Ă ů E Ğ ǁ  , Ž Ɖ Ğ  ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ  Ϯ Ϭ ϭ ϴ ƌ Ž Ž Ŭ ů LJ Ŷ Ğ Ŷ ƚ Ğ ƌ  Ͳ  Ϯ Ϭ ϭ ϵ 'Ž ů Ě Ğ Ŷ  s Ă ů ů Ğ LJ Ψϳ ͘ Ϭ Ϭ  Ψϴ ͘ Ϯ Ϭ  Ψϭ Ϭ ͘ Ϯ ϵ  Ψϭ Ϭ ͘ ϳ ϱ  Ψϭ Ϭ ͘ ϵ ϱ  Ψϭ ϭ ͘ ϵ ϴ  Ψ ϭ ϭ ͘ ϵ ϴ  Ψϭ ϰ ͘ Ϭ Ϭ  ZĞ Ɛ ŝ Ě Ğ Ŷ ƚ ŝ Ă ů  Z Ğ Đ LJ Đ ů ŝ Ŷ Ő   Ś Ă ƌ Ő Ğ  Ɖ Ğ ƌ  Y Ƶ Ă ƌ ƚ Ğ ƌ  Ĩ Ž ƌ  Ϯ Ϭ ϭ ϴ KƉ Ğ Ŷ  Ɖ Ƶ ď ů ŝ Đ  Ś Ğ Ă ƌ ŝ Ŷ Ő  Ĩ Ž ƌ  Đ Ž ŵ ŵ Ğ Ŷ ƚ Ɛ  Ž Ŷ  Ɖ ƌ Ž Ɖ Ž Ɛ Ğ Ě  ϮϬ ϭ ϵ  Ƶ ƚ ŝ ů ŝ ƚ LJ  ƌ Ă ƚ Ğ Ɛ Ž Ƶ Ŷ Đ ŝ ů  Đ Ž Ŷ Ɛ ŝ Ě Ğ ƌ Ă ƚ ŝ Ž Ŷ  Ž Ĩ ͗ ZĞ Ɛ Ž ů Ƶ ƚ ŝ Ž Ŷ  Ă Ě Ž Ɖ ƚ ŝ Ŷ Ő  Ϯ Ϭ ϭ ϵ  ǁ Ă ƚ Ğ ƌ  Ƶ ƚ ŝ ů ŝ ƚ LJ  ƌ Ă ƚ Ğ Ɛ ZĞ Ɛ Ž ů Ƶ ƚ ŝ Ž Ŷ  Ă Ě Ž Ɖ ƚ ŝ Ŷ Ő  Ϯ Ϭ ϭ ϵ  Ɛ Ğ ǁ Ğ ƌ  Ƶ ƚ ŝ ů ŝ ƚ LJ  ƌ Ă ƚ Ğ Ɛ ZĞ Ɛ Ž ů Ƶ ƚ ŝ Ž Ŷ  Ă Ě Ž Ɖ ƚ ŝ Ŷ Ő  Ϯ Ϭ ϭ ϵ  Ɛ ƚ Ž ƌ ŵ  Ɛ Ğ ǁ Ğ ƌ  Ƶ ƚ ŝ ů ŝ ƚ LJ  ƌ Ă ƚ Ğ Ɛ ZĞ Ɛ Ž ů Ƶ ƚ ŝ Ž Ŷ  Ă Ě Ž Ɖ ƚ ŝ Ŷ Ő  Ϯ Ϭ ϭ ϵ  Ɛ ƚ ƌ Ğ Ğ ƚ  ů ŝ Ő Ś ƚ  ƌ Ă ƚ Ğ Ɛ ZĞ Ɛ Ž ů Ƶ ƚ ŝ Ž Ŷ  Ă Ě Ž Ɖ ƚ ŝ Ŷ Ő  Ϯ Ϭ ϭ ϵ  ƌ Ğ Đ LJ Đ ů ŝ Ŷ Ő  ƌ Ă ƚ Ğ Ɛ YƵ Ğ Ɛ ƚ ŝ Ž Ŷ Ɛ ͍                    !"# $ %  $&'( )"*+ ' ,-   +$ + (#./0(  +0 +$'+"  +,$+,$("& '( 1'  $"+ "  $ !"'$'                               !      ! !      !"         !#           $  "   ,$("'2(,$("'$3' 4  '0$ !'  ( 5'" ,++"+(,$("6($(6""$$ !(56'7&+ $$ +($' $$!(,$("'$('+ +((6""+"$ ' ' +'0#+0##5 "  ('008'"$ #'$("4 "+7  ( ,$(" '$ (' '"$+ ( ## "$+  /9/ " 6 !6($(6'(0  "$06 ""'(#0+'7("$6"": ' !0(4 "+ +    ' 4" 0 $"''  + 0$ " ' + ( ,$(" '$('+"'  6((60(##0#+0  ('7((#"$' +'(  #'$(""$4-  9+ ($' $'$(+ "+$ $ $' $(" ,++"+(,$("2"$+;/  4"+!  <(37  "" +'$++ $" ''# +( 82  $3'$( "  $ !"'$4(06($(00$('"$+'7,00'$ +(0(  $"6'('""6( '( + (* +$$ 6($(6 "+""6$  #'$(" ''6((##!"+'' $0& ') 2&)37&++5' " " '$(" ''( 2  % "'+$3'$6 "+4 ++ #!+$('!''+$"6(+'$ '' #'$(" ''6((* +7  &)'' "'#$" '# '((: # 4"$(+##!"0 ()"  ''+   $"7% ((   $" #"$$+'(##!"0&)7 "'#$" '# (   $" #"$' '+&)06($(( ' '4  +7  $ '0(,$("'$1' $ !(+6((6(0 6 ""'( ,$("'$: '+   $"$'+0'" +#   (6 "+ ""6( ++6( ((#$''0+# # * + + ' " #'$(" ''+(#$''0& ') 7(: '+'" 6' !6+++#+(   $"  $4   +600$ +"7   $4/  ()"  ''("+# 4"$(+(: '+* +  + '+ #'$(" ''+: '4(##"$##!& ')  0( #"$0(" ,(,$("/9/"6!6($( '"$+6(( 82  $3'$+( "  $ !"'$7<$ '6 +4(# 4"$(40(# 4"$(+ (# 4"$(7  %""6$"'0(# 4"$(()"  ''"$+   '"2=8 3$ +   $"##!"0(: '+* + + '0 #'$(" ''+(: ' '' & ') 0( #'$(" '/9/"6!' 4>$(##"$ $ #"6(($+'' "+()"  ''#++ $4/  +( ''$+'" 7  <! 4.  (   $"##!+(0'+0(: ' +$'$'0 (# ./ 2*3  + 0 +$' + ' ( '$++ + # 4"$ ( 0 (  + : '$ 4   7 (' !(   $"##!+(& ' )  : ' 4 "    ,$("'7 ( : '' 6   '" 2/8 3 ##!+7  $#0(##++$6($(6 "+ +$'$'0( (#./2*3  + 0 +$''$(+0 !6+$'+7(0 ++$0"$'' " "  "" ++''+    $" '"  <7   8 / 2%    % &     '  ! !  (  !"         !#  &   & ( ) 37  <$'+(' 7  ! ,0,$ ,4"   1 CITY OF BROOKLYN CENTER Notice is hereby given that a public hearing will be held on the ____ day of __________, 2018, at 7:00 p.m. or as soon thereafter as the matter may be heard at City Hall, 6301 Shingle Creek Parkway, to consider an ordinance related to elementary and secondary school interim uses in the City’s commercial and central commerce overlay districts. Auxiliary aids for handicapped persons are available upon request at least 96 hours in advance. Please notify the City Clerk at 763-569-3306 to make arrangements. ORDINANCE NO. ________ AN ORDINANCE AMENDING CHAPTER 35 OF THE CITY CODE OF ORDINANCES REGARDING ELEMENTARY AND SECONDARY SCHOOL INTERIM USE IN THE CITY’S COMMERCIAL AND CENTRAL COMMERCE OVERLAY DISTRICTS THE CITY OF BROOKLYN CENTER DOES ORDAIN: Article I.Brooklyn Center City Code, Chapter 35, Section 35-310(3) regarding the R1 One Family Residence District is amended as follows: 3. Interim Uses a. Temporary classroom buildings as an accessory use to a public or p r ivate elementary or secondary school offering a regular course of study accredited by the Minnesota Department of Children, Families and Learning, subject to the following procedures and conditions: in Section 35-430. 1)Interim use permits will be issued in accordance with the procedures and subject to the conditions stated in Section 35-220. 2)At the time of granting such a permit the Council shall specify a date or event that can be identified with certainty by which the interim use must be terminated and the structure(s) shall be removed from the site. In any event, however, such interim use shall not continue beyond any date when the Council, or any other governmental body having the power of eminent domain, adopts a resolution approving acquisition of the property by eminent domain, or the zoning of the property is changed to any classification under which the interim use is no longer permitted. 3)The Council may impose any conditions on such interim use which it deems necessary or expedient to protect the public health, safety or welfare or to assure that permission for the interim use will not impose additional costs on the public if it is necessary or expedient to take the property in the future. 2 No such permit shall be issued unless the applicant first agrees in writing to the imposition of any such conditions. 4)In addition to any other conditions which may be imposed by the Council, the following restrictions shall apply: aa. Applicable lot standards and sign regulations shall be observed. bb. A landscape and parking plan for the property shall b e submitted and approved by the Council. cc. Unless approved by the Council pursuant to this section and section 35-220, no new buildings may be erected on the property and no existing buildings may be expanded while the interim use continues. dd. Temporary classrooms may be used for classrooms only and may not be used for storage or converted to another use. ee. The total square footage of temporary classrooms on any one site shall not exceed 2000 square feet. Article II.Brooklyn Center City Code, Chapter 35, Section 35-322 regarding the C2 Commerce District is amended as follows: 4. Interim Uses. a. Temporary public and private elementary and secondary schools offering a regular course of study accredited by the Minnesota Department of Education, subject to the procedures and conditions in Section 35-430. Article III. Brooklyn Center City Code, Chapter 35 is amended by adding a new Section 35-430 as follows: Section 35-430. TEMPORARY SCHOOL USES. 1. Interim Use. The use of temporary classroom buildings as an accessory use to a permanent or temporary public or private elementary or secondary school, and the use of property for a temporary public or private elementary or secondary school, allowed by this Chapter shall not occur except upon issuance of an interim use permit in accordance with the procedures and subject to the conditions stated in Section 35-220. 3 2. Application. An application for an interim use permit for a temporary school use allowed by this Chapter may only be submitted by an existing public or private elementary or secondary school located in the City of Brooklyn Center, offering a regular course of study accredited by the Minnesota Department of Education. The application for the interim use permit shall, in addition to the information required on the application form, include the following information. a. If the requested interim use permit is for an on-site temporary school building: (i) The number, size, and layout of any temporary classroom buildings to be located on the school site; (ii) Setbacks of any proposed temporary classroom buildings to property lines; (iii) Elevations and/or renderings of the proposed temporary classroom buildings; (iv) The number of students that will be served by the temporary classroom buildings; and (v) The reason for the need for temporary classroom buildings and the length of time they will be in use. b. If the requested interim use permit is for an off-site temporary school: (i) The location of the proposed temporary school; (ii) The number of students and faculty that will occupy the school; (iii) A transportation plan, which includes bus times and routes, number of buses, number of anticipated drop-offs, and drop-off locations; (iv) A parking and circulation plan; (v) The reason for the need for the temporary school and the length of time it will be in use; and (vi) If exterior modifications to the building are proposed, elevations and/or renderings of the proposed changes. 3. Issuance. An application for an interim use permit for a temporary school use shall be processed in accordance with Section 35-220, except that the following additional standards shall also be considered: a. The proposed use must conform to the regulations in this Chapter; 4 b. The date or event that will terminate the use can be identified with certainty; c. Allowing the use will not impose additional costs on the public if it is necessary for the public to take the property in the future; and d. The applicant agrees to the conditions the City Council imposes on the use. 4. Conditions. The City Council may impose any conditions on the interim use permits it issues as it deems are necessary or expedient to protect the public health, safety or welfare, or to ensure the use will not impose additional costs on the public if it is necessary or expedient to take the property in the future. Every interim use permit shall identify the date or event that will terminate the permit. The applicant shall either expressly agree in writing to the conditions imposed on the interim use permit or shall be deemed to have agreed to all such conditions without exception or reservation if the applicant undertakes the use allowed by the permit. 5. Performance Standards. In addition to any conditions placed on an interim use permit by the City Council, the following restrictions shall apply to interim use permits issued for a temporary school use. a. For temporary classroom buildings: (i) Applicable lot standards and sign regulations shall be observed; (ii) A landscape and parking plan for the property shall be submitted and approved by the Council; (iii) Unless approved by the Council, no new buildings may be erected on the property and no existing buildings may be expanded while the interim use continues; (iv) Temporary classrooms may be used for classrooms only and may not be used for storage or converted to another use; and (v) The total square footage of temporary classrooms on any one site shall not exceed 2000 square feet. b. For temporary schools: (i) Applicable lot standards and sign regulations shall be observed; (ii) A parking and circulation plan shall be submitted and approved by the Council; and 5 (iii) Unless approved by the Council, no new buildings may be erected and no existing buildings may be expanded on the property while the interim use continues. 6. Renewal. An application to renew an interim use permit for a temporary school use shall be submitted no fewer than 90 days prior to the termination of the existing permit, and processed in the same manner as a new application. Article IV.Brooklyn Center City Code, Chapter 35, Section 35-2240 regarding the CC Central Commerce Overlay District is hereby amended as follows: 3. Interim Uses. The following uses are allowed in the CC Central Commerce Overlay District with the issuance of an interim use permit. a. Temporary public and private elementary and secondary schools offering a regular course of study accredited by the Minnesota Department of Education, subject to the procedures and conditions in Section 35-430. 4. Thefollowing uses arenot permitted in theCC Central Commerce Overlay District: a.sauna establishments b.massage establishments c.currency exchanges d.pawn shops e.secondhand goods dealers 45.The following area is hereby established as being within the CC Central Commerce OverlayDistrict: The CC Central Commerce Overlay District is located within the area bounded by a continuous line beginning at a point located at the intersection of John Martin Drive and T.H. 100 and going southwesterly along the centerline of T.H. 100 to its intersection with Brooklyn Boulevard; thence northerly along the easterly right-of-way line of Brooklyn Boulevard to a point located approximately 445’ northerly of its intersection with County Road No. 10; thence east along an extended line made up of the south boundary lines of the plats for Grimes 2nd Addition, Hipp’s 4th Addition and Hipp’s 5th Addition, Hennepin County, continued to the centerline of Shingle Creek; thence northerly along the centerline of Shingle Creek to the centerline of I-94; thence easterly along said line to the centerline of 6 Humboldt Avenue North; thence southerly to the centerline of T.H. 100; thence southwesterly to the point of the beginning. Article V.Effective Date. This ordinance shall become effective after adoption and upon thirty days following its legal publication. Adopted this ___ day of __________, 2018. _______________________________ Tim Willson, Mayor ATTEST: _________________________ City Clerk Date of Publication Effective Date (Strikeout indicates matter to be deleted, double underline indicates new matter.)                 ! "#   $  %& '   () &*  +, +'"-(.*//0"                     '%1  2)( 3('#/' ' ('2('/#(''2')"((. "((, ('"2( "!22 4)( *//0"2% "5 2  5 (2!"  2454()26  2""*//0""' (, 5(  24"5(!"# #(/ (, ('"!27# ('"62/ "4/2*      '(/2 ' '(           &'.85' & "#"2   '(/" "# 5)(, ('" #/ //#"#(7' 9 # " "& "&':; ;84 25(4#5"' 42" 2#4&(! (4 ((! ( 2"(4+, 2   '("2((5)+, +'"4!((4 (5(2  2(!" 42&"  "4/ 5''( 2('"<"4( /2" ' ,  %&'.42" 2#4 ((4' 44'  =" "#"42"2((7' >  "  ! &4&' &%( //   DDKZEhD  dK͗ Ăƌď^ƵĐŝƵ͕ŝƚLJůĞƌŬ  &ZKD͗ dŝŵ'ĂŶŶŽŶŚŝĞĨŽĨWŽůŝĐĞ  d͗ KĐƚŽďĞƌϭϭ͕ϮϬϭϴ  ^h:d͗ ůĐŽŚŽůŽŵƉůŝĂŶĐĞŚĞĐŬͲ&ĂŝůƵƌĞ   KŶϭϬͬϵͬϭϴĂƚĂƉƉƌŽdžŝŵĂƚĞůLJϳ͗ϯϬƉ͘ŵ͘ŽĨĨŝĐĞƌƐĨƌŽŵƚŚĞƌŽŽŬůLJŶĞŶƚĞƌWŽůŝĐĞĞƉĂƌƚŵĞŶƚĐŽŶĚƵĐƚĞĚ ĂůĐŽŚŽůĐŽŵƉůŝĂŶĐĞĐŚĞĐŬƐĂƚĂůůŽŶͲƐĂůĞůŝƋƵŽƌůŝĐĞŶƐĞŚŽůĚĞƌƐǁŝƚŚŝŶƚŚĞŝƚLJŽĨƌŽŽŬůLJŶĞŶƚĞƌ͘ KĨĨŝĐĞƌƐǁĞƌĞĂƐƐŝƐƚĞĚďLJĂWdžƉůŽƌĞƌǁŚŽǁĂƐǁŽƌŬŝŶŐĨŽƌƚŚĞWĂŶĚŝƐƵŶĚĞƌƚŚĞĂŐĞŽĨϮϭ͘tŚĞŶ ƚŚĞdžƉůŽƌĞƌĂƚƚĞŵƉƚĞĚƚŽƉƵƌĐŚĂƐĞĂůĐŽŚŽůĂƚ:ĂŵŵŝŶtŝŶŐƐ͕ϮϱϵϬ&ƌĞĞǁĂLJůǀĚ͕ƚŚĞďĂƌƚĞŶĚĞƌƐĞƌǀĞĚ ƚŚĞdžƉůŽƌĞƌĂůĐŽŚŽůĞǀĞŶĂĨƚĞƌůŽŽŬŝŶŐĂƚƚŚĞƉƌĞƐĞŶƚĞĚ/ǁŚŝĐŚĐůĞĂƌůLJƐŚŽǁĞĚƚŚĞdžƉůŽƌĞƌƚŽďĞ ƵŶĚĞƌƚŚĞůĞŐĂůĂŐĞƚŽƉƵƌĐŚĂƐĞ͘  dŚĂƚďĂƌƚĞŶĚĞƌǁĂƐƚŚĞŶĂƌƌĞƐƚĞĚĂŶĚƉŽƐŝƚŝǀĞůLJŝĚĞŶƚŝĨŝĞĚǁŚŝĐŚŝƐŵĂŝŶƚĂŝŶĞĚŝŶƚŚĞŽĨĨŝĐŝĂůƉŽůŝĐĞ ƌĞƉŽƌƚ;ϭϴͲϬϬϰϯϬϬͿ͘dŚĞĂƌƌĞƐƚĞĚǁŝůůďĞĐŚĂƌŐĞĚǀŝĂĨŽƌŵĂůĐŽŵƉůĂŝŶƚǁŝƚŚĂĐŚĂƌŐĞŽĨ&ƵƌŶŝƐŚŝŶŐ ůĐŽŚŽůƚŽĂDŝŶŽƌ;'DͿ͘  dŚĞƌĞǁĞƌĞŶŽŽƚŚĞƌĂůĐŽŚŽůĐŽŵƉůŝĂŶĐĞĨĂŝůƵƌĞƐĚƵƌŝŶŐƚŚŝƐƌŽƵŶĚŽĨĐŽŵƉůŝĂŶĐĞĐŚĞĐŬƐ͘   01/22/18 -4- of which are located adjacent to Lilac Drive North. The subject area for vacation was formerly used for a section of roadway that is being removed as part of the Brooklyn Boulevard Corridor Project Phase 1. This vacated area would be used to mitigate the loss of parking on the Brookdale Covenant Church property due to the installation of a new signal at Highway 100 south ramp and the extension of Lilac Drive North. Mr. Cote described the land exchange agreement and explained the property owner will be required to dedicate a drainage and utility easement over the vacated portion of the right-of-way to maintain access to the existing utilities within the vacated area. He noted this item was first read on December 11, 2017, published in the official newspaper on December 21, 2017, and offered this evening for Public Hearing and adoption of the ordinance. Councilmember Ryan moved and Councilmember Butler seconded to open the Public Hearing. Motion passed unanimously. No one appeared to address this item. Councilmember Ryan moved and Councilmember Lawrence-Anderson seconded to close the Public Hearing. Motion passed unanimously. Councilmember Graves moved and Councilmember Ryan seconded to adopt ORDINANCE NO. 2018-01 Vacating a Portion of Right-of-Way: Lilac Drive North. Motion passed unanimously. 8b. CONSIDERATION OF LIQUOR LICENSE ENFORCEMENT ACTION AT JAMMIN WINGS, 2590 FREEWAY BOULEVARD City Clerk Sharon Knutson introduced the item and stated the purpose of this agenda item to consider liquor license enforcement action at Jammin Wings, 2590 Freeway Boulevard. She presented history of this consideration, explaining that on November 27, 2017, Mr. Brown, owner of Jammin Wings, submitted a renewal application and fee fo r a S t a t e a n d C i t y intoxicating liquor license and Sunday liquor license, as well as the City application for an optional 2 a.m. liquor license. On December 11, 2017, the City Council approved the issuance of these liquor licenses. On or about December 19, 2017, while preparing the licenses for issuance, she checked with the State of Minnesota Department of Alcohol and Gambling Enforcement Division website to make sure the 2 a.m. permit was active and discovered it had expired on August 1, 2017. Ms. Knutson stated she then contacted the Alcohol and Gambling Enforcement Division to confirm and they affirmed it had not been submitted as of that date. Ms. Knutson stated she informed the City Manager and then Mr. Brown that the permit had lapsed so the City could not issue a liquor license until that permit had been approved by the State. Mr. Brown informed her that he had not received that application from the State and was 01/22/18 -5- unaware it was not active at the time. Mr. Brown then took immediate action to renew the 2 a.m. permit with the State, which she confirmed with the State, and then issued that license. Ms. Knutson stated on January 8, 2018, she received an email notification from the State AGED and learned the check submitted by Mr. Brown was NSF for a closed account so, therefore, the permit was not valid. In consulting with the City Manager and City Attorney, it was agreed a violation of Minnesota Statutes, Section 340A.504, subdivision 7, had occurred. Ms. Knutson noted the City Attorney has drafted a memorandum, which was provided in the meeting packet, to outline the enforcement action options that can be considered by the City Council following the Public Hearing. Councilmember Lawrence-Anderson moved and Councilmember Graves seconded to open the Public Hearing. Motion passed unanimously. Mr. Brown explained that in the past, he got a package from the City to pay for the license and did not realize the State permit for optional 2 a.m. was due on August 1st. However, as the City Clerk stated, his account was closed. He said it was tampered with so the bank closed the account. He paid for the State permit, but the State took longer to go forward with the check and the account was closed by the bank on January 2, 2018. He stated he thought the State’s check had cleared but it did not. Mr. Brown stated he paid the check to the State as well as the bounced check fee. Mayor Willson explained that any time there is a violation, the City has to address it and it does not matter when it occurred, but that a violation did occur. So tonight, the City will hold the public hearing and obtain advice from staff as well as the City Attorney. Mr. Brown stated he would like a 4 a.m. license during the upcoming Super Bowl. Mayor Willson referenced the memorandum that contained the request for the 4 a.m. license, which is a different issue than what is under consideration at this time. Mr. Boganey asked questions of Mr. Brown to determine the dates the checks were written and when the account was closed. He recounted that the check was written on December 19, 2017, the State contacted the City on January 8, 2018, and the account closed on January 2, 2018. He asked if on December 19, 2017, when the check was written to the State there were sufficient funds on that date. Mr. Brown answered in the affirmative. Councilmember Graves moved and Councilmember Butler seconded to close the Public Hearing. Motion passed unanimously. City Attorney Troy Gilchrist clarified that on Page 1 of his memorandum, last sentence, it should indicate: “This violation does not rise to that level.” He described the range of options before the City Council for a liquor license violation, noting this does not trigger mandatory revocation but ranges from no penalty at all, a civil penalty up to $2,000, and/or suspension of the liquor license 01/22/18 -6- for no greater than 60 days. He noted with each option, there is flexibility including a limited suspension or imposition of a penalty with suspension of a portion conditioned on not having another violation. Mr. Gilchrist stated the civil penalty can be in addition to suspension or revocation. He noted the violation was focused on serving after 1 a.m. without the appropriate permit. Mayor Willson pointed out if the 2 a.m. permit is suspended, then the 4 a.m. permit cannot go forward. He asked about imposing an administration fee to cover staff time and expenses, such as is imposed with rental licenses, as well as a civil penalty so the violation is documented. Mayor Willson stated the City does not want to see any more violations but if one should occur, this will provide documentation to take stronger action. Mr. Gilchrist advised if the City Council is inclined to consider a suspension or revocation, he would recommend directing staff to prepare a resolution for consideration at the next meeting. Councilmember Graves stated the City has been working with this business on other issues and the City Council has considered its liquor licenses, seating, and other requirements as well. She stated she enjoys going to Jammin Wings and likes that it is open until 2 a.m., noting it is one of the only Black-owned businesses in the City. But that being said, Councilmember Graves wanted to assure the rules are followed so Jammin Wings can stay there. She stated she supports imposing a civil penalty of up to $2,000 and suspending it conditioned on there being no further violations. Mr. Brown pointed out that in the four and a half years he has been in business, there has been only one violation, which not many bars or restaurants can say. Mayor Willson stated the City needs to be consistent with enforcing its ordinances across the board. He offered the option to consider a $1,000 civil penalty plus $300 administrative fee to cover staff time and suspend the civil penalty. He noted this would be similar to a rental ordinance violation where an administration fee is charged. Mr. Boganey stated it would probably need to be a $1,300 civil penalty and suspending $1,000. He indicated the notion of $300 being the amount to account for staff time may not be an unreasonable assessment of cost when considering his time, and the City Attorney’s and City Clerk’s time in dealing with this issue over the past several weeks. Mayor Willson stated he would like to consider an administrative fee. Mr. Boganey asked whether the ordinance provides for an administrative fee penalty. Mr. Gilchrist agreed with Mr. Boganey that the penalty would need to be cast as a civil penalty, noting the City’s cost at $300 is modest but would be partial reimbursement. Councilmember Lawrence-Anderson stated that is less than she was thinking to impose but is willing to consider that level. She suggested the resolution cite that no further violations shall occur, noting the City wants to make sure the new liquor establishments it is trying to attract know they are required to follow the rules. Mayor Willson clarified the discussion was to suspend $1,000 of the civil penalty unless another violation were to occur. In that case, the $1,000 civil penalty would be imposed. 01/22/18 -7- Councilmember Ryan noted that testimony from Mr. Brown indicates there was no intentional negligence. He asked how it operates with the State when there is a glitch in the payment and whether there is no communication from the State to the license holder of the need to cure the situation. Ms. Knutson described the permitting and licensing procedure, explaining that with the 2 a.m. license, the State of Minnesota Alcohol and Enforcement Division authorizes the City to issue the liquor license. The State issues a permit for one year from whenever the applicant applies and the City issues its license the calendar year from January 1 to December 31. Ms. Knutson explained the State does not notify the City that someone did not renew their permit and from August 1 to December 19, Jammin Wings did not have permission from the Commissioner of Public Safety to operate until 2 a.m. She stated this is the first time this situation has occurred, and Mr. Brown indicated he did not get anything from the State to say he needed to renew his permit. Mr. Boganey explained the State timeframe is based on when the business owner makes application for their first permit. Up to this year, Jammin Wings always renewed the State permit but there was a change in the management structure of the business and that did not happen. Councilmember Ryan stated while it is the owner’s responsibility, it is an example of a mistake and they need to be held responsible but not in a punitive manner. He stated his support to consider a civil penalty with the greater part suspended unless subsequent violations occur. Mr. Gilchrist asked for a sense of duration for the subsequent violations. Mayor Willson stated the license will be renewed December 31 so the suspension could be through the license period. The City Council agreed with the logic to tie the violation term to the license term. Councilmember Ryan moved and Councilmember Graves seconded to direct staff to prepare a resolution to impose a $1,300 civil penalty, suspending $1,000, contingent upon no further liquor license violations. Motion passed unanimously. Councilmember Graves stated support to consider Jammin Wings’ request for a 4 a.m. liquor license. Mayor Willson asked staff if there is an underlying issue to not consider that request. Mr. Boganey stated he has no new information but in a previous memo discussing the optional 2 a.m. liquor license elimination, it was indicated that a significant number of violations and police calls occur after 1 a.m. Mayor Willson pointed out that another violation would go against the license. Mr. Brown noted it is only for a short period of time, during the Super Bowl, and they will increase security during that time. 01/22/18 -8- Police Chief Tim Gannon stated there are a select number of days and at this time, he would not oppose this request. Mr. Boganey indicated under the City’s ordinance, staff has the authority to issue this permit if it is not opposed by the City Council. The consensus of the City Council was to support the administrative issuance of a 4 a.m. liquor license to Jammin Wings during the Super Bowl. 9. PLANNING COMMISSION ITEMS - None. 10. COUNCIL CONSIDERATION ITEMS 10a. CONSIDERATION OF TYPE IV 6-MONTH PROVISIONAL RENTAL LICENSES Mayor Willson explained the streamlined process that will now be used to consider Type IV 6- Month Provisional Rental Licenses. Mayor Willson polled the audience and asked whether anyone was in attendance to provide testimony on any of the rental licenses as listed on tonight’s meeting agenda. Seeing no one coming forward, Mayor Willson called for a motion on Agenda Items 10a1 through 10a6. 10a1. 4200 JOYCE LANE 10a2. 6325 KYLE AVENUE N. 10a3. 6424 SCOTT AVENUE N. 10a4. RESOLUTION NO. 2018-26 APPROVING A TYPE IV 6-MONTH PROVISIONAL RENTAL LICENSE FOR 4450 58TH AVENUE N. 10a5. RESOLUTION NO. 2018-27 APPROVING A TYPE IV 6-MONTH PROVISIONAL RENTAL LICENSE FOR 6015 ALDRICH AVENUE N. 10a6. RESOLUTION NO. 2018-28 APPROVING A TYPE IV 6-MONTH PROVISIONAL RENTAL LICENSE FOR 6718 COLFAX AVENUE N. Councilmember Ryan moved and Councilmember Graves seconded to approve the issuance of a Type IV six-month provisional rental license and mitigation plan for the following: 4200 Joyce Lane, 6325 Kyle Avenue N., 6424 Scott Avenue N., and, adopt Resolution No. 2018-26 Approving a Type IV 6-Month Provisional Rental License for 4450 58th Avenue N.; Resolution No. 2018-27 Approving a Type IV 6-Month Provisional Rental License for 6015 Aldrich Avenue N.; and, Resolution No. 2018-28 Approving a Type IV 6-Month Provisional Rental License for 6718 Colfax Avenue N., with the requirement that the mitigation plans and all applicable ordinances must be strictly adhered to before renewal licenses would be considered. Motion passed unanimously.                 ! "#   $  %& '   () &*  ##+,!(-*../"01'23 2'" &  &(" 23 2'"                 4,"",!(-*../"01'(3 ('" &  &("23 2'"," ! ( #'((%#(' , " % !,,,  (-.!"#(' "  '( " .  ! &-&' &%( ..  #(1'(('                   ! "##$%& '(   )&!) "*+#",%   )) -*%&&!)-                        !"#   ".!/+     &%0,---&-##*-) !/#.--) ))-"1--&&!!)- )&2"  &%&!!))"#%%0-1 -,-#&-## %30"%& -&"))")& 2 "")&!-*%&&!!)- )&2 24!*%!*#!&-))-#%%%)"-*%/ ----" 2 +2)")##5&%%#-.&26 72 &"0)0"5 %&%%-#-.&26 824&% )"**-)"&)*--!9)/%0:")##5 %&%%-#-.&26 ;2))%*.-#<.%)+%&-"%)-= "!&!*%-*%4-*& &"&,%-2 "&"))&)-&*"&"-&!!))2 $*-)-*%&&!!)- )&)#&- 2%%#&-"0)5-6"./&")5"-*%26 2'1/-&/-*&&-0)#))**%%%%)"-*%/ ----0""  :&%%0 "&,>$%&0"&"= -&)&)-.!) *! &"&,>2 /: --0"&"&% )-"!)"!))--#"*! -?!,!)%)%&- *%#."&%?)#!#*!2 &:$.) %%%-##&*0"" #,% 2 ):- "%%##&-#"0-"* *!-)"-*-/%!*%--"%%*.) "!))-->!%)%*" !/" 2 :!"-*-/%!*%! -/*!--%%!-2 #:*%&-*&!-# --0"# -!)-.&#"&-& .)-/". - -*& -%!"""-*%&&!!)--##/-))1*&& %) -/%- -*&-%0# %2 +2@&%%#-.&A-&!%&..%#&&)%&%%#-.&=  *%&-*-?1&*!)&%!&-)!-&-)*&.*%&!- -/-.)/" &&-&&!!)**)--*))/" 2B "- *)))## "&%#-0"&%%#-.&-)# "&%#-"%!-%%#"*%& -.&&%%-0"-*--&--0 %)/&%& %)"&%%%2$%-, "0""-**-%%%*%&-*--9&% )"1&*-%)%-):0%%& 0)-" &%& %)%--#0"!,-"-.&&%%24"0)-""%!%-##1&* 0 %)/!.)#!")#2 72C0%% %3*--!#"5 %&%%-#-.&26"!"))! %&%%-# -.&-&%& %)/"% !/#*-**%&&%%* -""&)* --!2.)"- %/" !/#!-"-*&#&%)"-*%/ ---2"-*&-- 0%%-*&#&%%)#&"*%&&%%)--****%/-)"-.#" &)2 82$*-)"&)$'-! 8$-D% ! +$- "$ ! $-$ !-)%% " %%-#'.&9$ )&: >$%%!*% %%-#$%&EE *0 %)/!.)*&& &2 ;2%")'#4-*&#!-%-&")2"-#!0 %)/ %3)#%"-%) "-*%/ ----"".<.%+%&-*/-)"*%&&%%-#-.&"-2 4-/%.)"#"!)#&-")&0%%".*-.!*&/)&-* /%&-# &%%-#-.&)&--##%%0".-,% 6-%)"-*%/ -----0%% -"!*%-2  "))%-#)"%"-*&-"F-= )#%.%%.%+%&-0%%.%.-###!  %)) !! '))-24.0"& )*%"%!%--&-0#)" ."-*&-!/&--+**-2-).% / %)) !! '))-##- )))%-##0 %)/))&) &"--*&-2-- &" "/ )-- -*2  ! '#'& '/% !!  ŝƚLJŽĨƌŽŽŬůLJŶĞŶƚĞƌ ,ŽƐƉŝƚĂůŝƚLJĐĐŽŵŵŽĚĂƚŝŽŶ /ŶƐƉĞĐƚŝŽŶŚĞĐŬůŝƐƚ  ƵƐŝŶĞƐƐEĂŵĞͬĚĚƌĞƐƐͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ/ŶƐƉĞĐƚŝŽŶĂƚĞͺͺͺͺͺͺͺͺͺͺͺͺ  DĂŶĂŐĞƌͬ^ƵƉĞƌǀŝƐŽƌEĂŵĞͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ EŽ͘ŽĨZŽŽŵƐ/ŶƐƉĞĐƚĞĚͺͺͺͺͺͺͺͺͺͺͺ   /ŶƚĞƌŝŽƌZĞƋƵŝƌĞŵĞŶƚƐ ͺͺϭ͘&ůŽŽƌƐ͗ŚĂůůǁĂLJƐ͕ ƐƚĂŝƌǁĂLJƐ͕ŐƵĞƐƚƌŽŽŵƐ͕ ďĂƚŚƌŽŽŵƐĂŶĚƐƚŽƌĞƌŽŽŵƐ ĂƌĞĐůĞĂŶ͕ƐĂŶŝƚĂƌLJ͕ƐŵŽŽƚŚ͕ ŝŶŐŽŽĚƌĞƉĂŝƌ͕ĂŶĚĂƉƉƌŽǀĞĚ ĐŽǀĞƌĂŐĞ͘ ͺͺϮ͘tĂůůƐĂŶĚĐĞŝůŝŶŐƐ͗ ŚĂůůǁĂLJƐ͕ƐƚĂŝƌǁĂLJƐ͕ŐƵĞƐƚ ƌŽŽŵƐ͕ďĂƚŚƌŽŽŵƐĂŶĚƐƚŽƌĞ ƌŽŽŵƐĂƌĞĐůĞĂŶĞĚ͕ƉĂŝŶƚĞĚ͕ ĂŶĚŝŶŐŽŽĚƌĞƉĂŝƌ͘ ͺͺϯ͘^ƚƵĚƐ͕ũŽŝƐƚƐ͕ƌĂĨƚĞƌƐĂƌĞ ŶŽƚĞdžƉŽƐĞĚĞdžĐĞƉƚǁŚĞŶ ƐƵŝƚĂďůĞ͘&ŝŶŝƐŚĞĚĂŶĚŬĞƉƚ ĐůĞĂŶ͘ ͺͺϰ͘tŝŶĚŽǁƐĂƌĞƉƌŽƉĞƌůLJ ƐĐƌĞĞŶĞĚ͘ ͺͺϱ͘ůůƌŽŽŵƐĂŶĚŚĂůůǁĂLJƐ ƵƐĞĚďLJƉĂƚƌŽŶƐĂƌĞǁĞůůůŝƚ͘ ͺͺϲ͘ZŽŽŵƐĂƌĞǀĞŶƚŝůĂƚĞĚ ŽƵƚƐŝĚĞ͘ ͺͺϳ͘dĞŵƉĞƌĞĚ͕ŵĂŬĞͲƵƉĂŝƌ ĚƵƌŝŶŐǁŝŶƚĞƌ͘ ͺͺϴ͘ůůƌŽŽŵƐŵĞĞƚ ŵŝŶŝŵƵŵŚĞĂƚƌĞƋƵŝƌĞŵĞŶƚƐ  ĂƚŚƌŽŽŵZĞƋƵŝƌĞŵĞŶƚƐ ͺͺϵ͘dŽŝůĞƚŝƐŝŶŐŽŽĚƌĞƉĂŝƌ͘ ͺͺϭϬ͘^ŚŽǁĞƌͬdƵďŝƐŝŶŐŽŽĚ ƌĞƉĂŝƌ͘ ͺͺϭϭ͘ƉƉƌŽǀĞĚƐŽƵƌĐĞŽĨ ǁĂƚĞƌĂŶĚĂĚĞƋƵĂƚĞƐƵƉƉůLJ ƵŶĚĞƌƉƌĞƐƐƵƌĞ͘ ͺͺϭϮ͘,ŽƚǁĂƚĞƌĚŽĞƐŶŽƚ ĞdžĐĞĞĚϭϯϬĚĞŐƌĞĞƐ &ĂŚƌĞŶŚĞŝƚ͘    WůƵŵďŝŶŐĂŶĚ^ǁŝŵŵŝŶŐ ͺͺϭϯ͘ZWŝŶƐƉĞĐƚŝŽŶƌĞƉŽƌƚ ŝƐŵĂĚĞĂǀĂŝůĂďůĞ͘ ͺͺϭϰ͘tĂƚĞƌ^ŽĨƚĞŶĞƌĐůĞĂŶ ĂŶĚŵĂŝŶƚĂŝŶĞĚ͘ ͺͺϭϱ͘tĂƚĞƌŚĞĂƚĞƌƐĂƌĞŝŶ ŐŽŽĚƌĞƉĂŝƌ͘ ͺͺϭϲ͘WƵďůŝĐƉŽŽůƐĂŶĚ ĨĂĐŝůŝƚŝĞƐŝŶƐƉĞĐƚŝŽŶƌĞƉŽƌƚ ŵĂĚĞĂǀĂŝůĂďůĞ͘  hŶŝƚƐ;ϭϱйŽĨĂůůƌĞǀŝĞǁĞĚͿ ͺͺϭϳ͘ŽŽƌůŽĐŬƐ;ĚĞĂĚďŽůƚͿ͘ ͺͺϭϴ͘tŝŶĚŽǁƐĞĐƵƌŝƚLJŽŶĂůů ǁŝŶĚŽǁƐ͘ ͺͺϭϵ͘EƵŵďĞƌĐůĞĂƌůLJ ŝĚĞŶƚŝĨŝĞĚĂƚĞĂĐŚƵŶŝƚ͘ ͺͺϮϬ͘LJĞǀŝĞǁƐŝŶĞĂĐŚ ĚŽŽƌ͘ ͺͺϮϭ͘^ƚƌŝŬĞƌƉůĂƚĞĂŶĚ ƐĐƌĞǁƐŝŶƉůĂĐĞ͘ ͺͺϮϮ͘^ŵŽŬĞĂŶĚKůĂƌŵƐ ŝŶŽƉĞƌĂďůĞĐŽŶĚŝƚŝŽŶ͘  ŽŵŵŽŶƌĞĂƐ ͺͺϮϯ͘^ƵƌǀĞŝůůĂŶĐĞŝŶ ǁŽƌŬŝŶŐŽƌĚĞƌ;ŝĨƌĞƋƵŝƌĞĚŽƌ ƉƌŽǀŝĚĞĚďLJƚŚĞƉƌŽƉĞƌƚLJ ŽǁŶĞƌͿ͘ ͺͺϮϰ͘EŽdƌĞƐƉĂƐƐƐŝŐŶƐĂƚ ĂůůĞŶƚƌĂŶĐĞƐĂŶĚͬŽƌƉůĂĐĞĚ ŝŶůŽĐĂƚŝŽŶƐƚŚĂƚĐĂŶďĞ ĐůĞĂƌůLJƐĞĞŶďLJĂůůŐƵĞƐƚƐĂŶĚ ǀŝƐŝƚŽƌƐ͘ ͺͺϮϱ͘WƌŽƉĞƌůŝŐŚƚŝŶŐ͘ ͺͺϮϲ͘ůĞǀĂƚŽƌŝŶƐƉĞĐƚŝŽŶ ƌĞƉŽƌƚŝƐĂǀĂŝůĂďůĞŽŶƐŝƚĞ ͺͺϮϳ͘&ŝƌĞŝŶƐƉĞĐƚŝŽŶƌĞƉŽƌƚ ŝƐĂǀĂŝůĂďůĞŽŶƐŝƚĞ ͺͺϮϴ͘ƵŝůĚŝŶŐ͕ƉůƵŵďŝŶŐ͕ ŵĞĐŚĂŶŝĐĂů͕ĞůĞĐƚƌŝĐĂůĂŶĚ ŽƚŚĞƌďƵŝůĚŝŶŐƉĞƌŵŝƚƐĂƌĞ ĐůŽƐĞĚŽƵƚ ͺͺϮϵ͘hƚŝůŝƚLJƌŽŽŵƐĂƌĞĐůĞĂƌ ŽĨƐƚŽƌĂŐĞĂŶĚŵĞĐŚĂŶŝĐĂů ĂŶĚĞůĞĐƚƌŝĐĂůĞƋƵŝƉŵĞŶƚŝƐ ĂĐĐĞƐƐŝďůĞ  WƌŽƉĞƌƚLJdžƚĞƌŝŽƌ ͺͺϯϬ͘'ƌŽƵŶĚĐŽǀĞƌƉůĂŶƚƐ ĚŽŶŽƚĞdžĐĞĞĚƚŚƌĞĞĨĞĞƚŝŶ ŚĞŝŐŚƚ͘ ͺͺϯϭ͘WůĂŶƚƐƵŶĚĞƌǁŝŶĚŽǁƐ ĂƌĞŵĂŝŶƚĂŝŶĞĚĂƚĂŚĞŝŐŚƚ ƚŚĂƚŝƐďĞůŽǁƚŚĞǁŝŶĚŽǁƐŝůů͘ ͺͺϯϮ͘dƌĞĞƐĂƌĞƚƌŝŵŵĞĚƐŽ ƚŚĞůŽǁĞƌďƌĂŶĐŚĞƐĂƌĞĂƚ ůĞĂƐƚĨŝǀĞĨĞĞƚŽĨĨƚŚĞŐƌŽƵŶĚ͘ ͺͺϯϯ͘>ĂŶĚƐĐĂƉŝŶŐĚŽĞƐŶŽƚ ŝŶƚĞƌĨĞƌĞǁŝƚŚůŝŐŚƚŝŶŐ ĚŝƐƚƌŝďƵƚŝŽŶ͘ ͺͺϯϰ͘^ƵƌǀĞŝůůĂŶĐĞŝŶ ǁŽƌŬŝŶŐŽƌĚĞƌ ͺͺϯϱ͘'ƌŽƵŶĚĐŽǀĞƌƐƵĐŚĂƐ ŵƵůĐŚĂŶĚƌŽĐŬŝƐĂĚĞƋƵĂƚĞ ƚŽƉƌŽǀŝĚĞĐŽǀĞƌ͘ ͺͺϯϲ͘WƌŽƉĞƌƚLJͬĨĂĐŝůŝƚLJĨƌĞĞ ŽĨůŝƚƚĞƌĂŶĚƌƵďďŝƐŚ͘ ͺͺϯϳ͘'ĂƌďĂŐĞƌĞĐĞƉƚĂĐůĞƐ ĂƌĞĐůĞĂŶĂŶĚŝŶŐŽŽĚƌĞƉĂŝƌ͘ ͺͺϯϴ͘dƌĂƐŚĞŶĐůŽƐƵƌĞƐĂƌĞ ƉƌŽƉĞƌůLJƐĐƌĞĞŶĞĚĂŶĚŝŶ ŐŽŽĚƌĞƉĂŝƌ͘ ͺͺϯϵ͘džƚĞƌŝŽƌůŝŐŚƚŝŶŐŝƐ ŽƉĞƌĂďůĞĂŶĚĨƵŶĐƚŝŽŶĂů͗ ͺͺƵŝůĚŝŶŐĞdžƚĞƌŝŽƌ͘ ͺͺdƌĂƐŚĞŶĐůŽƐƵƌĞƐ͘ ͺͺŶƚƌLJĂŶĚĞdžŝƚƉŽŝŶƚƐ͘ ͺͺWĂƌŬŝŶŐůŽƚƐ͘  dŚĞĂďŽǀĞŵƵƐƚďĞĐŽƌƌĞĐƚĞĚĂƐŝŶĚŝĐĂƚĞĚ͘&ĂŝůƵƌĞƚŽĐŽŵƉůLJŵĂLJƌĞƐƵůƚŝŶĨƵƌƚŚĞƌĂĐƚŝŽŶ͘  ĂƚĞ͗ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ  ZĞĐĞŝǀĞĚLJ͘ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ŽŵŵƵŶŝƚLJĞǀĞůŽƉŵĞŶƚ  ϳϲϯͲϱϲϵͲϯϯϯϬͲWŚŽŶĞ ϲϯϬϭ^ŚŝŶŐůĞƌĞĞŬWŬǁLJ  ϳϲϯͲϱϲϵͲϯϯϲϬͲ&Ădž ǁǁǁ͘ĐŝƚLJŽĨďƌŽŽŬůLJŶĐĞŶƚĞƌ͘ŽƌŐ  ŽŵŵĞŶƚƐͬŽƌƌĞĐƚŝŽŶKƌĚĞƌƐ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ REVISED DRAFT 12-2-18 1 539005v6 TJG BR291-4 CITY OF BROOKLYN CENTER Notice is hereby given that a public hearing will be held on the ____ day of __________, 2018, at 7:00 p.m. or as soon thereafter as the matter may be heard at City Hall, 6301 Shingle Creek Parkway, to consider an ordinance related to hospitality accommodations. Auxiliary aids for handicapped persons are available upon request at least 96 hours in advance. Please notify the City Clerk at 763-569-3306 to make arrangements. ORDINANCE NO. AN ORDINANCE AMENDING CHAPTER 23 OF THE BROOKLYN CENTER CITY CODE REGARDING HOSPITALITY ACCOMMODATIONS THE CITY OF BROOKLYN CENTER DOES ORDAIN: Article I. Brooklyn Center City Code, Chapter 23, Sections 23-2400 through 23-2415 are hereby amended by deleting them in their entirety and replacing them with the following: HOSPITALITY ACCOMMODATIONS Section 23-2400. PURPOSE. It is the purpose of these Sections 23-2400 through 23- 2415 to ensure that hotels and motels (referred to collectively in these Sections as a “hospitality accommodation”) are complying with certain minimum standards and are implementing measures as may be needed to discourage the use of their facilities for criminal activities in order to protect the safety of their guests and the public. Those owning and operating hospitality accommodations in the City have a responsibility to ensure their guests and visitors have accommodations that are safe, secure, free from unreasonable noise, nuisances, and threats to their safety and security. Section 23-2401. LICENSE REQUIRED. It is unlawful for any person, firm, or corporation to operate a hospitality accommodation in the City without a hospitality accommodation license issued pursuant to Sections 23-2400 through 23-2415. A separate license is required for each hospitality accommodation property. Section 23-2402. DEFINITIONS A. “Annual calls for service” – The aggregate total of all the points, specified in Section 23-2404(E), assigned to the calls for service to a hospitality accommodation property in a calendar year divided by the total number of lodging units in the hospitality accommodation as determined by the City. B. “Call for service” – Includes any of the following: REVISED DRAFT 12-2-18 2 539005v6 TJG BR291-4 1. Any report made to the police department of criminal activity, violation of the city code, or a general call for service requiring a police response from or concerning a hospitality accommodation in connection with an incident occurring at that hospitality accommodation property, except calls for a medical emergency or domestic assault; or 2. Any incident observed by police concerning a hospitality accommodation property and is responded to by a police officer. Only a call for service that is verified by the responding police officer as being a valid call for service shall be included in the annual calls for service calculation for the purposes of these Sections 23-2400 through 23-2415. C. “Hospitality accommodation” – Any facility such as a hotel, motel, condominium, resort, or any other facility or place offering six or more lodging units to guests for periods of less than thirty days, but not including jails, hospitals, care facilities, senior living centers, residential treatment facilities, prisons, detention homes, and similar facilities. D. “Hospitality accommodation property” – Any land containing a facility for hospitality accommodation including any associated parking areas, recreation areas, loading areas, or other amenities located on the same parcel of property. E. “Hospitality accommodation license” or “license” – A license issued by the City to a level I hospitality accommodation, a level II hospitality accommodation, or a level III hospitality accommodation. F. “Level I hospitality accommodation” – Any hospitality accommodation whose annual calls for service are less than .20 calls per lodging unit. G. “Level II hospitality accommodation” – Any hospitality accommodation whose annual calls for service are at least .20 calls per lodging unit, but less than .40 calls per lodging unit. H. “Level III hospitality accommodation” – Any hospitality accommodation whose annual calls for service are at least .40 calls per lodging unit or greater. I. “Lodging unit” – One self-contained unit within a hospitality accommodation designated by number, letter, or some other method of identification that is designed or used for overnight accommodations. A lodging unit shall not include areas or rooms not utilized for overnight accommodations such as banquet rooms, meeting rooms, business centers, pool areas, and workout rooms. J. “Part 1 crime” – Any crime identified in the Uniform Crime Reporting Program as a Part 1 crime, but which does not constitute a “violent crime” as defined in REVISED DRAFT 12-2-18 3 539005v6 TJG BR291-4 this Section. Part 1 crimes include, but are not necessarily limited to, theft, auto theft, burglary, or arson (first, second, or third degree). K. “Police department” – The City of Brooklyn Center Police Department. L. “Property safety inspection” – An annual inspection of level II and level III hospitality accommodations conducted by the City based on a hospitality accommodation inspection checklist developed by the City and adopted by the City Council. M. “Violent crime” – Is any homicide (any degree), robbery, criminal sexual conduct (first, second, or third degree), or assault (first, second, or third degree). Section 23-2403. RESTRICTIONS ON ISSUING LICENSES. A hospitality accommodation license shall not be issued or renewed if any of the following circumstances exist: A. The applicant submits an incomplete license application or fails to submit the required application fee; B. The applicant is untruthful in any of the information provided to the City as part of its request for a license; C. The hospitality accommodation is not in compliance with the requirements associated with the particular license level applicable to the hospitality accommodation; D. The applicant has failed to correct any violations noted in a correction order issued as a result of safety inspection required under Section 23-2412; or E. The hospitality accommodation property is not in compliance with any applicable federal, state, or local law, rule, regulation, or ordinance. Section 23-2404. LICENSING PROCESS AND RENEWAL. The level of a hospitality accommodation license shall be determined and the licensed shall be issued in accordance with this Section. A. A new hospitality accommodation shall obtain a hospitality accommodation license from the City prior to opening for business. A new hospitality accommodation that had not previously operated within the City shall initially qualify for a level I hospitality accommodation license. The City may charge a reduced license fee for a new hospitality accommodation license based on the number of months remaining in the particular licensing period. B. The annual renewal of a hospitality accommodation license shall be in accordance with the following timelines: REVISED DRAFT 12-2-18 4 539005v6 TJG BR291-4 1. By February 1st the City shall notify each existing hospitality accommodation in writing of its annual calls for service for the previous year and the level of hospitality accommodation license for which it must apply; 2. By April 1st each hospitality accommodation shall submit to the City a complete application for the appropriate level of license; 3. By May 1st each hospitality accommodation must obtain the required level of hospitality accommodation license from the City; and 4. By June 1st each hospitality accommodation shall be in full compliance with any conditions placed on the license by the City Council, unless a different compliance date is indicated in the license or a provisional license is issued because of change in licensing levels. C. The City Council shall issue a hospitality accommodation license upon submission of a complete application, payment of applicable fees, compliance with the applicable special requirements, compliance with any correction orders, and proper licensing with all applicable government agencies, including the Minnesota Department of Health. D. If a hospitality accommodation is required, based on its annual calls for service, to transition to a stricter licensing level, the City Council may issue a provisional license to allow additional time for the hospitality accommodation to come into compliance with the additional special requirements applicable to the new level. The hospitality accommodation is required to come into full compliance with the requirements applicable to the new license level and any additional conditions placed on the license by the City Council by the date indicated in the provisional license. The City shall conduct an inspection and if it determines the hospitality accommodation has complied, the license automatically becomes a regular license for the particular license level without further action by the City. If the hospitality accommodation is not in compliance by the date indicated, the provisional license shall terminate unless the City Council acts to extend it. Any such extension approved by the City Council shall be subject to any additional conditions the City Council may place on the license. E. The following scale shall be used to calculate the number of points assigned to a hospitality accommodation for the calls of service to determine t h e l e v e l o f license the hospitality accommodation is required to obtain. Type of Call for Service Points Violent crime 5 Points Part 1 crime 3 Points Any other crime or call for service 2 Points REVISED DRAFT 12-2-18 5 539005v6 TJG BR291-4 If an employee of the hospitality accommodation originated the call for service, the number of points assigned to the particular call for service shall be reduced by one point. F. To determine the type of hospitality accommodation licenses required, the City shall divide the annual calls for service at a hospitality accommodation, calculated using the point system set out in paragraph E of this Section, by the total number of lodging units in the hospitality accommodation. G. A hospitality accommodation may be subject to a property safety inspection as provided in Section 23-2412 and any such hospitality accommodation shall comply with any correction orders issued as a result of the inspection. H. Failure of a hospitality accommodation to comply with the requirements applicable to the license level, any additional conditions issued by the City Council, or a correction order shall constitute sufficient grounds for the revocation, suspension, or nonrenewal of the hospitality accommodation license. Section 23-2405. LICENSE FEE. The fee for a hospitality accommodation license shall be as set forth by City Council resolution. The City Council may establish a separate fee for each licensing level. Section 23-2406. LICENSE PERIOD. All hospitality accommodation licenses shall expire on April 30 each year and must be renewed in accordance with Section 23-2404. Section 23-2407. TRANSFER OF LICENSES. A hospitality accommodation license may be transferred to a new owner of a hospitality accommodation continuing to operate on the same hospitality accommodation property for which the license was issued. The transfer shall not affect the current license level and the calls for service that occurred prior to the transfer shall be used in calculating the license level at renewal. Written notice of the transfer shall be provided to the City within ten business days after the transfer. The notice shall include the name and address of the person, firm, or corporation taking ownership or control of the hospitality accommodation. A hospitality accommodation license shall not be transferred or relocated to a hospitality accommodation located on a different site. Section 23-2408. LEVEL I HOSPITALITY ACCOMMODATION. A level I hospitality accommodation is required to meet the special requirements in this Section, which constitute the minimum performance standards for all hospitality accommodations. A. Have clear check-in policies that, at a minimum, require all guests reserving or renting a room to use a credit card to guarantee the reservation or rental. B. Provide and keep a register for the registration of all guests, and every guest must be registered. Upon the arrival of each guest, the operator of the hospitality accommodation must require the guest to provide the name and home address of REVISED DRAFT 12-2-18 6 539005v6 TJG BR291-4 the guest and every person with the guest as a member of the party, and if the guest is traveling by motor vehicle, the make of the vehicle and license plate number, including the name of the state or country issuing the license plate. The method of payment must be noted as part of the registration information. The registration information must be recorded in the guest register and kept in an accurate and orderly manner. The guest register must be retained for one year and made available for inspection by the City upon reasonable request. C. Work cooperatively with the City to provide training no less than annually to all staff members directly involved in registering guests and housekeeping staff. D. Provide the City the name, address, e-mail address, and telephone number of the president, vice-president, secretary, and treasurer of the ownership group of the hospitality accommodation. E. Provide the City the name, e-mail address, and telephone number of all managers and other responsible employees of the hospitality accommodation. F. Require a manager or other responsible employee to be on premises of the hospitality accommodation property at all times. G. Inspect rooms of guests who refuse housekeeping service for three consecutive days or who behave suspiciously in a manner staff reasonably suspect, based on training and experience, may be engaged in unlawful activity. Section 23-2409. LEVEL II HOSPITALITY ACCOMMODATION. A level II hospitality accommodation is required to meet the special requirements required of a level I hospitality accommodation and the additional special requirements in this Section, which are designed to deter crime, in order to be eligible for a hospitality accommodation license, and shall comply with any conditions the City Council may impose on the license. A. Submit a management plan to the City detailing steps the hospitality accommodation intends to take to reduce criminal activity. B. Consult with the police department to obtain such inspection services and advice regarding crime prevention as may be needed to address the types and calls for service made to the hospitality accommodation property. C. Consult with the police department to keep apprised of police activity occurring on the hospitality accommodation property. D. Install and operate a surveillance camera, with a recorder, in the lobby at all times. REVISED DRAFT 12-2-18 7 539005v6 TJG BR291-4 E. Consult with the police department to undergo a “crime prevention through environmental design” (CPTED) inspection and incorporate the recommendations into the hospitality accommodation property. F. Issue parking passes to all vehicles allowed to park on the transient accommodation property, each pass marked with an issued date and expiration date. G. Submit to semi-annual audits by the City to verify compliance w i t h t h e requirements of this Section. Section 23-2410. LEVEL III HOSPITALITY ACCOMMODATIONS. A level I I I hospitality accommodation is required to meet the special requirements of a level II hospitality accommodation, and including those applicable to a level I hospitality accommodation, and the additional special requirements in this Section, which are designed to deter crime, to be eligible for a hospitality accommodation license, and shall comply with any conditions the City Council may impose on the license. A. Conduct background checks on all owners, managers, and employees of the hospitality accommodation in accordance with Section 23-2411. B. Enforce the following guest rules: 1. Lodging units cannot be rented for less than a six-hour period; 2. Prohibit guests from producing loud noises that unreasonably disturb the tranquility of the other guests or those adjacent to the hospitality accommodation property; and 3. Alcohol may not be consumed in common areas except for designated banquet or reception rooms or areas. C. Remove all graffiti and repair all vandalism within seven days of occurrence. D. Install lighting in all common areas with minimum maintained lighting of 1.5 foot-candles at ground level. E. Install and continually operate video monitoring equipment in all parking lots on the hospitality accommodation property that are monitored and recorded at the front desk at all times. F. Have a licensed, armed, and uniformed security guard on the premises every day from 6:00 p.m. until 6:00 a.m. Section 23-2411. BACKGROUND CHECKS. REVISED DRAFT 12-2-18 8 539005v6 TJG BR291-4 A. A hospitality accommodation required to conduct background checks on its owners, managers, and employees, such background checks must comply with and include the following: 1. A Minnesota statewide criminal history check covering at least the last three years, which must be conducted by a company providing criminal history check services utilizing the most recent update of the Minnesota criminal history files; 2. A statewide criminal history check from the person’s previous states of residence covering the last three years if the person has not resided in Minnesota for at least the three years preceding the history check; and 3. A criminal history check conducted in all seven counties in the Twin Cities metropolitan area (the counties of Anoka, Carver, Dakota, Hennepin, Ramsey, Scott, and Washington) covering at least the last three years, including all misdemeanor, gross misdemeanor, and felony convictions. B. The hospitality accommodation shall retain the criminal history check information for the duration of the person’s employment, but in no case less than two years, and shall make the information available for inspection upon request by the City Manager or the City Manager’s designee. Section 23-2412. PROPERTY SAFETY INSPECTION. The City shall conduct property safety inspections in accordance with the provisions of this Section. A. The City shall annually conduct a property safety inspection of all level II and level III hospitality accommodations for the purpose of enforcing the property maintenance code and the standards in this Section. The property safety inspection is required prior to the issuance of a level II or level III hospitality accommodation licenses. The City may at all reasonable times enter and inspect all lodging units, common areas, and operational areas of the hospitality accommodation. Except when otherwise authorized by law or in an emergency, the City shall not inspect an occupied lodging unit without the consent of the occupant. B. Property safety inspections shall include the following: 1. At least 15% of all lodging units in the hospitality accommodation shall be inspected. The City shall determine which lodging units to inspect and shall rotate the lodging units inspected to ensure all lodging units will be inspected periodically; 2. All common areas and operational areas of a hospitality accommodation shall be inspected as part of each property safety inspection; and REVISED DRAFT 12-2-18 9 539005v6 TJG BR291-4 3. The inspection shall be based on a hospitality accommodation inspection checklist and the City shall inspect each item on the list during each inspection. C. Any violations found during the property safety inspection shall be corrected in the timeframe established in the correction order issued by the City. The City shall conduct a reinspection of the hospitality accommodation to confirm compliance with the correction order. Failure to correct any of the violations noted in a correction order within the established timeframe may result in the suspension, revocation, or nonrenewal of the hospitality accommodation license as provided in Section 23-2413. Section 23-2413. REVOCATION AND SUSPENSION OF LICENSE. A hospitality accommodation license may be revoked, suspended, or not renewed by the City Council, upon recommendation of the City Manager, in accordance with this Section. A. The City Council may revoke, suspend, or not renew a hospitality accommodation license upon any of the following grounds: 1. A false statement, misrepresentation, or fraudulent statement on any application or other information or report required by these Sections 23- 2400 through 23-2415; 2. Failure to pay the application fee, fine, penalty, reinstatement fee, special assessment, real estate taxes, or other financial claim due to the City under this Code; 3. Failure to comply with any of the special requirements applicable to the level of license held by the hospitality accommodation; 4. Failure to comply with any of the conditions placed on the license by the City Council; 5. Failure to comply with any part of a correction order resulting from a property safety inspection within the timeframe indicated in the order; 6. Failure to continuously comply with any zoning, health, building, nuisance, or other Code requirements; 7. Failure to obtain or maintain any licenses required for the hospitality accommodation; or 8. Failure to comply with any other applicable federal, state, or local law, rule, regulation, or ordinance. REVISED DRAFT 12-2-18 10 539005v6 TJG BR291-4 B. A decision to revoke, suspend, or not renew a hospitality accommodation license shall be preceded by written notice to the applicant or licensee of the alleged grounds therefor and the applicant or licensee will be given an opportunity to request a hearing before the City Council before final action is taken to revoke, suspend, or not renew the license. An applicant or licensee waives its right to a hearing if it fails to submit a written request for a hearing to the City within ten days of the issuance of the written notice. If a timely request for a hearing is received, the City Council shall conduct a hearing at the next regularly scheduled City Council meeting and provide the applicant or licensee an opportunity to be heard. C. The written decision to revoke, suspend, or not renew a hospitality accommodation license shall identify the specific grounds for the decision. Upon issuance of the written decision, no lodging unit within the hospitality accommodation may be offered or used for any period of time by guests until a new hospitality accommodation licenses is issued in accordance with Section 23- 2414. Section 23-2414. REAPPLICATION AFTER LICENSE ACTION. Reapplication for a hospitality accommodation license after the City Council has revoked, suspended, or not renewed a license shall be in accordance with this Section. A. A hospitality accommodation license may be suspended for up to ninety (90) days and may, after the period of suspension, be reinstated subject to compliance with these Sections 23-2400 through 23-2415 and any conditions imposed by the City Council at the time of suspension. B. A hospitality accommodation license revoked or not renewed by the City Council will not be reinstated or issued until the owner has applied for and secured a new hospitality accommodation license and complied with all conditions imposed at the time of revocation or nonrenewal. The City Council may impose a period following the revocation or nonrenewal of the owner’s previous license during which a new hospitality accommodation license may not be submitte d . A decision not to renew a hospitality accommodation license may take the form of a suspension or revocation. C. An application for a new hospitality accommodation license following the revocation, suspension, or nonrenewal of the license must be accompanied by a reinstatement fee, as specified by City Council resolution, in addition to all other application and related fees. D. The conditions of approval of any subsequent application for a license to operate a hospitality accommodation on the same property following a period of revocation or denial of renewal of a hospitality accommodation license shall be REVISED DRAFT 12-2-18 11 539005v6 TJG BR291-4 based upon the hospitality accommodation property's history of annual calls for service prior to the revocation or non-renewal. E. No subsequent application for a hospitality accommodation license on the same property following a period of revocation or nonrenewal shall be approved unless the applicant presents a corrective action plan that is approved by the City to help ensure the conditions and causes of the prior revocation or nonrenewal are appropriately addressed. Implementation of, and compliance with, the corrective action plan shall be a condition of the license. Section 23-2415. VIOLATIONS. A. Any person, firm, or corporation who violates any provision of these Sections 23- 2400 through 23-2415 is, upon conviction, guilty of a misdemeanor. The penalty that may be imposed for a misdemeanor is a sentence of not more than 90 days or a fine of not more than $1,000, or both. Each day upon which a violation of these Sections 23-2400 through 23-2415 occurs constitutes a separate offense. B. In lieu of issuing a criminal citation, the City may issue an administrative citation and impose a civil penalty on any person, firm, or corporation who violates any provision of these Sections 23-2400 through 23-2415. C. Any person required to register at a hospitality accommodation who intentionally presents false identification, provides a false or assumed name, or otherwise provides false guest register information is guilty of a misdemeanor. D. Nothing in this Section shall be construed as a waiver of any applicable state license requirements or from compliance with all applicable civil and criminal laws. Article II.Brooklyn Center City Code, Chapter 23, Section 23-006.05 is hereby amended by deleting the stricken material and adding the double underlined material as follows: Section 23-006.05. PAYMENT OF PROPERTY TAXES REQUIRED. No license shall be granted or renewed for tobacco related products; bowling alleys; public dancing; filling stations; pawnbrokers; secondhand goods dealers; motor vehicle dealerships; saunas and sauna baths; massage parlors; rap parlors, conversation parlors, adult encounter groups, adult sensitivity groups, escort services, model services, dancing services, or hostess services; transient hospitality accommodations; or amusement devices for operation on any property on which taxes, assessments, or other financial claims of the state, county, school district, or city are due, delinquent, or unpaid. In the event a suit has been commenced under Minnesota Statutes, Section 278.01 through 278.03, questioning the amount or validity of taxes, the City Council may on application waive strict compliance with this provision; no waiver may be granted, however, for taxes or any portion thereof which remain unpaid for a period exceeding one (1) year after becoming due. REVISED DRAFT 12-2-18 12 539005v6 TJG BR291-4 Article III.Effective Date. This ordinance shall become effective after adoption and upon thirty days following its legal publication. Adopted this ___ day of __________, 2018. _______________________________ Tim Willson, Mayor ATTEST: _________________________ City Clerk Date of Publication Effective Date                   !"# $ %  &''('# $)  !"#  *&   ($ ( +#)+  () ($'( ,$'                            !"    - ''' #" .    +   $" !-(   ' #"$' "  ))(/" + '0 +#"$'-#'(+  $"('))"  $" /))(/" + '(!$'-++!/--+ "#"$' (+' "))'0+' #"$'+!/('((('''#$)$#/" '"(+$)-))(/" '+ #'!)1'))(/"+ '(+#$)2'+'0  '(+('$ ''  $"($(')) +"("("-' '+ )#"' "(+$$#$)*$ 3 $+'0*$+ +$ '+!' $(-+($ -+$+ - "( +! /( "("(' )  ('$  /'( -++   +( ! $+'  0 #"''##"+($'0*))-""$  +#$''(-""/+ /$  $"'+ "(++$  ())( 0     +  -   ' ''  *  ) ) -  ' " '(   $  ( /    / $  +   ,$ ($ ) ) + $'(/  $"0  +4! /5     $"6''''))#'(((") /  ,$ ($$" (())($-+$+-' ("()' "($'(#( / *0 7 ' , $+)"( ( " 0  + ')) - ($(  / +  ,$ ($+ '  '')!-($ (0  +  '  '' !-( + ($  + 4! /       '  '' 0 +  '  ''   '"#''( $ (##!")+ ,$ ($0+ '  ''(( +)""-$ (($+'-+$++! /)"$(+ #((($0  0 8$'+$ 9   :( !+   :) '9  0+) 9 #$) +9 ")'/'($ 0 0 *$;.000 0 +" 9 $) ()$'"'-""/ (-+5 (')+. ;(#$#(('0+#! '" 9 ( )$")+"("(((  ()$'+"'+()""-+()+ . ;(#$#(0 50 *$5<0 ")$+-  +'+#$#(- "(/-+5 +' "' .('0 =0 ;.000(> '-()("!+$+ ""-((" 0% 1 #")+"("(+(("!'+$'+$'""#!(+$+ / "0  # $       '+!" )"##+'$'('+'!' '0'##'$++('' $ )--' $#" #! '($''$+'$$" +'#$')+"' +)$1'' )+/ "(0+# #')+ ,$($')?+ ')+1'"'). (#() ""-'  "$'+ "(+(0  +($9 '--) ""$$ ))(/"+ '###"$ /)'')+--$'''$'1''('' "'"$ ) +## #" ';-"'-+ $ '-+5 +')+# $+' "" $+'+ ')+"'' "+"$) +##0+($+'+))$ ))?"' '). (')+'")##0+# #''""-'+@5A +' "$)$''0  +' ($ - "(B ) -+ + '" )  "" $$  ))(/" + ' +-!C  - "( #!("$'''$+')$''0+($- "(9 -/ ')' -+5 (')' /'!$+'+"')+$ !' "$)$''0   + ($ ()' D  'D ' +  !"  #!' ) + 2' " + ' #!'' # ) "$ '(' $)##(' /+#$0+' '+-"("( - "(//";-"'1$#)+'''( +#$#(0"("( - "('""//"!$+ ++#$"""#$''0  +($"' '#$)$)$#$''+$" ('/+)$)+'(+  -+--'+#)+##$$ '0  %    '#$)+($+'))$ '+!$$'/ "'+)$ ) ' '-+)"'+-("$/)'/ +"("()"'+(04)+ +$'++!(#(' "($'+!("-++''' ($"-++($06+" + $9 ($ ) +"("(+++! +)$9  '+ ')('# ''+ '#' (+('# 08+' + () -+)"'++($+'/!"(- "(/+ ++$ '0"("($  $/$'"( '#$''+' $+'# ' 0  + 2'))$+'#!(() "-+$' +''  (+'#'-'++'$"#++- "(+!/' '+"("(' /'(+""(($!"'0+ /## )"-' /)"(0-!+ '$"""#++'#)$/$ '- "(/-+$ '' 0  +# #')+($'+"("' ). (' #'")##-- ""-' )(-+ ''+ "(+(04--'""""+(-""' #"-+. (' +"'"' '++( ("$/)'-""!( /#('+'' ))$ -"""""$  #0-!+ - "(/(#' (('''' '+!)('# /-+"("(((+($)+- $  #0  &'  (  )  *))+!#!((+()($ ")!-0+##$+" +'  #" (+$+' "$ ((0-!+' '(++ "'$'( ((< ;((!$$)##'('"0 "' ''*                  +,                            +*  *))!-(+(!$$)'"#"$-++  $"+#"-'''(1#''( $$')+#"$+ 0*))2'# $$'+  )+) "(+ $)'"+-' (-+'('/ ((+ 2'"/"('08((+ (!$($)'"#"$ '+'))-++'")##("("('+! 1#''('$$!' (($'9 $')('"'( ( "$'+$' )$9 ''0  8'#'+,$ ($'))$+( '!""("('+$ ' + #!(# +##'(($0""+'"(1#''(!""$$ / +($('#''/" (($'9 $'/ $-"((+-'"" /"0 $''($" (( 7("('-+$-""$''# '++##' '(+# !-)+($0 +($-""$'$9 '$''/(((("$$''+)'. (' -+$+ ('' (/ '0 +($(('$'')/ '$ #"+( ("$##(/$ '+ ($'-((' $-++$ #"$#$( '0 7("('(+++ ' '$$"$"(+ ++'))(/"+ ''' + -++!$$- "(! ""'/"?/$ #'+('#"$ ())(/" - "("-'/' $+"$$0 7("('$ (+" 2'+ ' -' 9 +-+"+'($ - "())$ '"##'/$ ')+"  )))(/"" '+  ('#"$ -''")'' +''$ '-++!)-))(/" " '('+($ /'$''0 - .&  8)+  $"##!'+)'()+($-""+   $")'$(( (# /"$+& =+ .0  +-""/')) "+)$ )+($0-!'$ "$#( ++(("-"(-""' "(("'))0  % +'" -""// +)-(+ )+# /"$+"+"$$'' ''$(-++'($0  ! '($ $*/"                 !"# $%&  '# (#                    )*** "! +   ,  #!  )( * "!#* !  --(.! ,*/ ,"!#*)"*(, #!(*--! #!.--(.! ,*( #*),, .)),!"!#*(,*!--*/,* "!#*, .(*(((***"#-#".!*!(,#-)--(.!*, "* -0*--(.!,*(,"#-1*,*/  *(,(*#** #!(#(*--,!(!(!)**, -"!* !(,##"#-$# 2#,*/$#,,#*, *#(),(# ),#, )!( ,  .( !(!(* - (*# .*( ),,   ,( #,*  / "!**""!,(#*/$--)!!#,"#**()!!.,.# #!*,!(,,#(--(/   , ) *** $-- )* !* (#(  . .# , '# (# - -, #*(. #!/,""*-,*(*#***"( #!,*#,,,*.( ,*"#*#,(*(#- #!,)"#(/  *'# (#3'#45,*)!(6))-!! ##--(.!,*"""!#.-**-,))#** *#*0**(*"!*7)!*),#*),,*-,"#,*/, (#,*,--#--8!**-+ (*-,*!-""/,""**!!) *,34,*!#-#**/ ,* (# )!(9 - ), , *! - !! ##--(.!,*,) : )!(" (***#,*-#**/ ,(#)!(6).*-*), (*-*.* #,*, !*-,# *!#-#**/ ,"!##!((**("!".*-.! )," "#,*""#),,*"!#/ ,*(#)!(, --#(,*,##(,!)#***( ; -#!*,*"")* #(",*!-,""/ $/;*'!#,-!((<!(2!!, ("(*!(#*/ "!**,"#**-"" *!(#/ !*#*((*,"#(#!(-#/ -,#*),, ("(,*(#, ,( -# # *  !(!(- !,*(#/  (-(#""(., *#,(- )(#*(/$/;*' !!(-(,(#"*,"),* !-,!(!(**)!!*--(.!,* ( #*/=)*.(!*""(/,(-**!,-$/;*'1*(#,-!(1*),* (-#*/ ,"#6*)!(.(,!!#*""!#"#**( (#)!((." (((-""# ,)!#*/ *#*,"-7)!*,###(,"#"(/ *#*!#,*,*-,!*" ,!(!(-#,(*," ,(,"#"(/  ,(#)!("!!((#* *.("#,*".!( , /"(,*-,).,,,!(#,*!** #!(--#,--"#,*/0*!(!(*$/;*'(#(,,*)*- ##*!*,).)*)!!)-,6*,)!(..!.!(, "-/  *"#-,(#,*--#*, ##*.!*,-#- **),-!*,)(!#.-*.,!(!(-!*,(/>-, ,#*,, ("(*!(#*, (!),,***(#!),,(#/?,! , #6(#-,!(!(,,, ,-#6*, *-(*"**, *"*(,(*"/=,*,(- ),-!*,,(#,*. !()!(.,,,#*/!(!(# #.#*!(*"#**,*!!"*/  ,""*-,(#***!!,!(!*-+ (*"*!-"" ))!!)*-(),**,!(,(/>))*!!!!,()!! *"!),+ (*,!*!**,,((!# .-*)!! (."(*,**--#)!!!!!#"/@) ,  )!(.("*((*****, -(*".),!(!(( (,(#-,)#"/ !" ### *, #!6((!-("#.-##!(--, "!##*#**A ,#((#,*,(-(#,*,!(.#*((A ,#(-(#)!(""!!-!""*),!* B-,* --(.!C B-,(#3=4/@!#((, #*( (,(-(#*,)!(""!!7-!""*),!* --(.!,*,!(* B=/  ?!(,  #!),@* ** ),(#( #(.-, #!*#A   #  $!# *(##$.! MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment DATE: April 9, 2018 TO: Curt Boganey, City Manager FROM: Jesse Anderson, Deputy Director of Community Development THROUGH: Meg Beekman, Community Development Director SUBJECT: Affordable Housing Policy Recommendation: It is recommended that the City Council consider providing direction to staff regarding potential affordable housing policies for the City. Background: In May of 2017, the City Council received copies of emails forwarded by Councilmember Butler from African Career and Education Resource Inc. (ACER) requesting an opportunity to come before the City Council to discuss concerns about the need for affordable housing in Brooklyn Center. In addition Mayor Willson was in contact with a representative of Community Action Partnership of Hennepin County (CAPHC) regarding the same topic. On July 10, 2017, by consensus the City Council directed staff to invite representatives from ACER and CAPHC to a future work session to present information and have a dialogue on the issue of affordable housing. On August 14, 2017, the City Council received a presentation from ACER and CAPHC regarding the topic of affordable housing. At the presentation ACER and CAPHC advocated that the City consider adopting policies that would address the region’s need for affordable housing, protect tenants, and help preserve naturally occurring affordable housing. The Council directed staff to bring the subject back to a future work session for discussion. Regional Housing Trends: The Twin Cities Metropolitan Area is currently experience record low vacancy rates. According to Marquette Advisors’ midyear report in August 2017, the average vacancy rate across the Twin Cities metro was 2.4 percent. Experts agree that a balanced rental market will typically see an average vacancy rate of around 5 percent. The impact of low vacancy rates over time has increased rents, a growing interest from outside investors, and landlords in a position to be choosier about who they rent to. This has borne out throughout the Twin Cities Metropolitan Area as rents have gone up throughout the region. The average rent at the end of July 2017 had increased 3.1-pecent year over year. In addition, the Metropolitan Council is seeing a reduction in the number of landlords accepting Section 8 MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment vouchers. According to the Metropolitan Council, landlords are citing the increased interest for their units from non-voucher holders as the primary reason for the change. Yet another impact of the increasing value of rental property is the growing number of investors purchasing Class B or Class C rental properties, which are renting for naturally affordable rents, making cosmetic improvements, and increasing rents so that the units are no longer affordable. According to the Minnesota Housing Partnership, the sales of apartment buildings in the metro area jumped 165 percent between 2010 and 2015. Often the change in ownership will also come with a change in policy related to criminal history, acceptance of Section 8 vouchers, or minimum income requirements, resulting in existing tenants being displaced from the property. The region is also seeing a loss of smaller-sized rental properties (1-4-units). This is due, in part to single family properties converting back into owner-occupied as the market recovers from the recession, but also a growing number of local investors purchasing smaller properties and flipping them. While some of the proposed policies would impact single family rentals, the primary focus of affordable housing advocates and media attention has been on larger properties (40-units or greater). Affordable housing advocates have identified potential policies designed to address these issues. The policies fall into one of three categories; 1) preservation policies designed to preserve naturally occurring affordable housing and prevent it from being flipped; 2) tenant protection policies designed to prevent or mitigate displacement; and 3) creation policies designed to create new, legally-binding, affordable housing that will replace the naturally occurring affordable housing that is being lost. Brooklyn Center’s Current Rental Housing: According to the Metropolitan Council, the following table indicates what is considered affordable rents in the Twin Cities Metropolitan Area: # of Bedrooms 30% AMI 50% AMI 60% AMI 80% AMI Efficiency $474 $791 $949 $1,265 1-Bedroom $508 $848 $1,017 $1,356 2-Bedroom $610 $1,017 $1,220 $1,627 3-Bedroom $705 $1,175 $1,410 $1,880 4-Bedroom $786 $1,311 $1,573 $2,097 *Rents include tenant-paid utilities According to the Metropolitan Council, the following table indicates average rents in Brooklyn Center: # of Bedrooms Survey 5-Year Avg Efficiency $730 $744 1-Bedroom $869 $801 2-Bedroom $1,019 $925 3+ Bedroom $1,281 $1,147 MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment Brooklyn Center currently has 834 rental license holders. 713 of those are for single family homes. 71 of the licenses are for 2-4-unit properties. 24 are for properties with between 5 and 39 units. 27 licenses are for properties with greater than 40 units. There are approximately 4,300 rental units in the City. The average rents in Brooklyn Center are considered affordable for those making around 50 percent of the Area Median Income. Of the 11,608 total housing units (both rental and owner-occupied) in Brooklyn Center, 89.5 percent are naturally occurring affordable housing. There are currently 402 Section 8 voucher holders in the City. Brooklyn Center currently has five apartment building that are legally-binding affordable housing, Ewing Square Townhomes (23-units), The Crest Apartments (69-units), Unity Place (112-units), Emerson Chalet Apartments (18-units), and The Sanctuary (158-units). Also, Lynwood Apartment (50-units) is currently applying for Certified Low Income Status, which would make it a legally-binding affordable property. This equates to 3.7 percent of the City’s housing stock is legally-binding affordable housing. Anecdotally, a recent phone survey of 34 Brooklyn Center landlords found a current average vacancy rate of 1.3 percent. Rents in Brooklyn Center are currently very affordable compared to the region. Low rents may be contributing to the low vacancy rates. If the vacancy rates are in fact below 2 percent, and they remain that low over time, it would be reasonable to expect rents to increase. However, given the current low rents, even an increase in rents of 20-30 percent would result in rents still considered affordable for those making 60-80% AMI. Affordable Policy Options: Section 8 Ordinance (Tenant Protection) - Prohibiting discrimination against Section 8 voucher holders and other recipients of government programs. The policy would prohibit landlords from denying any tenants’ application based on the applicant receiving government assistance. x Staff surveyed 34 Brooklyn Center apartments and found that 50 percent indicated that they do not accept section 8 vouchers. x Minneapolis recently adopted this ordinance, which allows applicants who feel they have been discriminated against to seek damages through the city’s department of Civil Rights. x The City of Minneapolis has an active lawsuit filed against them by 55 apartment owners over the legality of this ordinance. The lawsuit argues the mandate conflicts with state law and unfairly forces them to comply with requirements of federal housing voucher programs for low-income residents. It also says the law violates the Minnesota Constitution because it reduces their property values, forces landlords to enter into contracts and represents an unnecessary government intervention in their businesses. Landlords also claim that this could cause landlords to increase rent and/or application criteria as to price out Section 8 vouchers. ¾ Staff feels that if the ordinance is upheld by the courts, it could be a useful tool to ensure residents are not discriminated against based on their source of income; however additional review would be necessary related to the enforcement of the ordinance. Staff MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment recommends that the City monitor the Minneapolis lawsuit then review pending the outcome. Notice of Intent to Sell (Preservation) – Rental property owners must give advanced notice prior to the sale of a rental property. This gives a preservation buyer an opportunity to match the purchase price. It would also give service providers additional time to relocate residents who would be displaced as a result of the sale. x Landlords would be concerned about delaying the closing of a property sale, which could have a negative effect on price. Preservation companies such as Aeon have expressed concerns that this could increase the competition for these properties, and thusly increase sales prices. x Enforcement would be difficult because the penalty would come after the sale has occurred. If the property has sold, the seller no longer has ties to the property so enforcing a citation could be challenging and may not be a deterrent. In a workgroup in St. Louis Park landlords stated that if there was a $1000.00 citation for selling without notice, they would likely still sell the property and pay the citation. x It is unclear who the seller would need to notify of their intent to sell and what would be done with that information once it was known. Who would decide what buyers could have access to the information? Who would be responsible for disseminating the information? x It is possible that this ordinance would dissuade investors, who may opt to purchase property in cities that do not have the additional requirements. x St. Louis Park is looking at an alternative ordinance related to tenant transition/protection would address the need for additional time to relocate tenants. ¾ Staff recommends that the city consider other options such as the tenant transition ordinance. Tenant Transition/Protection Ordinance (Tenant Protection) – This would require a new owner of a naturally occurring affordable housing property to pay relocation benefits to tenants if the new owner increases rent, rescreens existing residents or implements non-renewals without cause within 3 months after the purchase. The ordinance has the effect of freezing lease terms for 90 days after the sale of a property. The purpose is to allow tenants three (3) months to relocate if necessary. x This ordinance wouldn’t interfere with the sale of naturally occurring affordable housing, however; it would provide assistance to the tenants if necessary. x The ordinance would require new buyers to notify tenants within 30 days if substantive changes to the lease are forthcoming, giving tenants time to relocate if necessary. x St. Louis Park adopted the Tenant Protection Ordinance in March of 2018. x The policy could dissuade potential apartment buyers from buying in Brooklyn Center, who may opt to purchase a property in a city without this policy. ¾ Staff recommends that the City review this policy further to determine the legality of it, the enforcement mechanism, and what the specific impacts in Brooklyn Center might be. MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment Just-Cause Eviction (Tenant Protection) – Also known as Just-Cause Non-Renewal, this would require a landlord to provide a reason if they were going to not renew a tenant’s lease that was expiring. Currently landlords must provide a just cause for eviction, which a tenant can appeal in court. There is no appeal process available to tenants who lose their housing due to non-renewal of lease. x Landlords see this as taking away a valuable management tool for dealing with problem tenants and have the unintended consequence of increasing the number of evictions filed and strengthening screening standards. x When St. Louis Park conducted their meetings with landlords and t h e M u l t i - f a m i l y Housing Association, this ordinance received the strongest opposition. x The enforcement of this policy would be through the court system and would require a tenant to take legal action against their landlord via a lawsuit. x Of the 34 landlords surveyed by staff, the majority of evictions or non-renewals are the result of non-payment of rent or criminal activity. x The intent of this ordinance would be to protect tenants from being non-renewed in the event a new owner wants to empty a building in order to do a substantial renovation with the goal of increasing rents. ¾ Staff recommends that the City consider other options such as the tenant transition ordinance to protect tenants. Inclusionary Housing Policy (Creation) – These are a collection of policies that could be adopted by the city which would either encourage or require new affordable units to be included as part of new market-rate residential development projects which receive public subsidy or other discretionary City approvals. Frequently it is in the form of a requirement that a percentage of units be affordable in a new residential development in exchange for public subsidy of the project. x New developments such as the Opportunity Site would be required to include a certain number of affordable units. x Inclusionary Housing policies ensure that new affordable units are added as market-rate units are built, thus ensuring mixed-income communities. x Cities such as St. Louis Park and Minneapolis have found that in higher rent developments, a certain percentage of affordable units can be required without increasing the need for additional public subsidy. This is due to the higher than average market rents, which off-set the affordable units. In Brooklyn Center, as is true in communities with lower average rents, it is likely that the cost of the affordable units would require additional public subsidies in order for a project to be financially feasible. ¾ If the Council would like to move forward with this police staff would recommend reviewing the feasibility of future development if an affordable housing policy is adopted. 4D Tax Breaks (Preservation) – Also known as the Low Income Rental Classification Program (LIRC), Minnesota provides a property tax break, currently amounting to 40%, to subsidized rental properties under LIRC, commonly referred to as the 4D program. There is the potential, MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment however, to extend 4D eligibility to certain currently unsubsidized affordable properties, without changing current law. This is because the LIRC/4D statute defines eligible properties as those which meet two conditions: the owner of the property agrees to rent and income restrictions (serving households at 60% AMI or below) and receives “financial assistance” from federal, state or local government. This presents the possibility of creating a “Local 4D” program in which qualifying properties receive the 4D tax break in return for agreeing to conditions which meet certain local government policy goals. x A government agency would need to provide a financial contribution to a rental apartment with a low income agreement placed on the property. The property could then be eligible to apply for 4D status. This would allow a landlord to make physical improvements to the property in exchange for affordable rents. x The reduction in property taxes would not decrease the City’s revenue from property taxes, as the funds would be distributed to all other properties; however, it would reduce that property’s share of local property taxes. x The amount of the tax break is a limiting factor as it equates to around $80/unit per year; however, the program may be an incentive for a property owner in a community where the market rents are already considered affordable, since they would not need to depress their rent rates. x Hennepin County is looking into a rehabilitation program for rental properties which would function similarly to the CDBG housing rehabilitation program, but be County funded. x The City could also look at funding a program for rental housing rehabilitation. ¾ Staff recommends working with the County to determine the feasibility of a County-led program. The City could also review EDA or TIF 3 Housing funds to determine the availability of funds for a city program that would provide rental housing rehab assistance in exchange for a 5-10 year affordability requirement. This could be set up as a per unit matching forgivable loan. Other Policies/Programs x Identify buildings that are at-risk of being flipped. Reach out to owners of at-risk buildings and gauge their short and long-term plans. Help connect them with preservation buyers on a case-by-case basis. x Comprehensive Plan – the City is in the process of updating its Comprehensive Plan. If the preservation and/or creation of affordable housing are a priority for the City, it should be reflected in the City’s Comprehensive Plan. x Education – Work with the Metropolitan Council to provide education on Section 8 voucher programs to dispel some of the negative perceptions of the program. Policy Issues: Does the Council believe that the information presented indicates a need for additional policy actions to address the concerns raised regarding affordable housing and the protection of tenant rights? MEMORANDUM – COUNCIL WORK SESSION Our Vision: We envision Brooklyn Center as a thriving, diverse community with a full range of housing, business, cultural and recreational offerings. It is a safe and inclusive place that people of all ages love to call home, and visitors enjoy due to its convenient location and commitment to a healthy environment Does the Council require additional information regarding these issues before concluding if further policy actions are necessary? Which policies if any would the Council want brought back for further consideration? Which policy does the council consider a higher priority? Strategic Priorities: x Resident Economic Stability Attachments: US Census Bureau Data Metropolitan Council Land use Chart August 14, 2017 Council Work Session Memo August 14, 2017 Council Work Session Minutes Housing Strategies Table Presented at Previous Work-Session Mixed-Income Housing Policies among Neighboring Cities Table Phone Survey of Brooklyn Center Apartments Phone Survey of Brooklyn Center Single Family Property Management Companies: US Census Bureau Data: Metropolitan Council Land Use Chart: gg g g y/ P r o g r a m T y p e Af f o r d a b i l i t y R e q u i r e m e n t s Af f o r d a b i l i t y Pe r i o d Op t - ou t ( a l t e r n a t i v e ) o p t i o n s En f o r c e m e n t T o o l O nc i a l a s s i s t a n c e f o r ve l o p m e n t s c r e a t i n g 10 m u l t i - fa m i l y u n i t s at i o n o f a n e x i s t i n g mi l y d e v e l o p m e n t ea s t 1 0 u n i t s . x 1 8 % o f t o t a l u n i t s i n t h e de v e l o p m e n t r e q u i r e d a t 6 0 % AM I o r 1 0 % o f u n i t s r e q u i r e d af f o r d a b l e a t 5 0 % A M I . x Fa m i l i e s m a y r e m a i n i n t h e dw e l l i n g u n i t a s l o n g a s t h e in c o m e d o e s n o t e x c e e d 1 2 0 % AM I . x 2 5 y e a r mi n i m u m (c o n s i d e r i n g an i n c r e a s e ) . x S u b j e c t t o C i t y C o u n c i l ap p r o v a l : o De d i c a t i o n o f e x i s t i n g u n i t s o O f f s i t e c o n s t r u c t i o n n e a r pu b l i c t r a n s i t o Pa r t i c i p a t i o n i n c o n s t r u c t i o n of a f f o r d a b l e u n i t s b y a n o t h e r de v e l o p e r w i t h i n t h e C i t y x A f f o r d a b l e H o u s i n g Pe r f o r m a n c e A g r e e m e n t be t w e e n C i t y a n d De v e l o p e r p r i o r t o Z o n i n g Co m p l i a n c e P e r m i t b e i n g is s u e d . x I m p l e m e n t e de v e l o p m e 1, 0 7 3 u n i t s pr o d u c e d . x N o d e v e l o p op t i o n . x U n i t s m u s t de v e l o p m e th r o u g h o u t ap p r o v e d b ng o r C o m p r e h e n s i v e me n d m e n t f o r a l l n e w mi l y d e v e l o p m e n t o f or e u n i t s . x 1 0 % o f a l l r e n t a b l e a r e a a t 50 % A M I o r 2 0 % o f a l l r e n t a b l e ar e a a t 6 0 % A M I . x 1 5 y e a r mi n i m u m . x D e d i c a t i o n o f e x i s t i n g u n i t s eq u a l t o 1 1 0 % , m u s t b e eq u i v a l e n t q u a l i t y . x Ne w c o n s t r u c t i o n a t a d i f f e r e n t si t e . x Pa r t i c i p a t i o n i n c o n s t r u c t i o n o f af f o r d a b l e u n i t s b y a n o t h e r de v e l o p e r w i t h i n t h e C i t y . x L a n d u s e r e s t r i c t i v e co v e n a n t . x PU D o r d i n a n c e s t a t e s de v e l o p m e n t m u s t co n s i d e r a f f o r d a b i l i t y . x C i t y w i l l c o n de v e l o p m e ho u s i n g i n c pa r k i n g r e d in t e r e s t l o a Fo u n d a t i o n ra t e r e s i d e n t i a l me n t w i t h 1 0 o r m o r e d r e c e i v e : na l U s e P e r m i t ( o r d . ) Un i t D e v e l o p m e n t Ma p A m e n d m e n t he n s i v e P l a n me n t nc i a l A s s i s t a n c e x 1 5 % o f t o t a l p r o j e c t u n i t s a t 60 % A M I o r 1 0 % o f p r o j e c t un i t s a t 5 0 % A M I . x Fa m i l i e s m a y r e m a i n i n t h e dw e l l i n g u n i t a s l o n g a s t h e in c o m e d o e s n o t ex c e e d 1 2 0 % AM I . x 2 0 y e a r mi n i m u m . x E q u a l o r g r e a t e r a m o u n t de d i c a t i o n o f e x i s t i n g u n i t s . x A f f o r d a b l e H o u s i n g Pe r f o r m a n c e A g r e e m e n t . x M i x o f p o l i c y a n d or d i n a n c e . x C i t y w i l l c o n in c l u d i n g : x M i n i m u m i n re q u i r e d p a x M i n i m u m o f rk e t r a t e r e s i d e n t i a l me n t w i t h 1 0 o r m o r e d r e c e i v e : De v e l o p m e n t (o r d . r e q u i r e d ) Ma p A m e n d m e n t qu i r e d ) he n s i v e P l a n me n t nc i a l A s s i s t a n c e x 1 5 % o f u n i t s a t 6 0 % A M I o r 10 % o f u n i t s a t 5 0 % A M I o r 5 % of u n i t s a t 3 0 % A M I x 2 0 y e a r mi n i m u m . x C o n s i d e r a n a lt e r n a t i v e pr o p o s e d b y d e v e l o p e r . x A f f o r d a b l e H o u s i n g Pe r f o r m a n c e A g r e e m e n t . x M i x o f p o l i c y a n d or d i n a n c e . x U n i t s m u s t de v e l o p m e th r o u g h o u t ap p r o v e d b is t e d h o u s i n g of 1 0 o r m o r e u n i t s . is t a n c e i n c l u d e s T I F , na t i o n , l a n d b u y x V a r i e s b a s e d o n f u n d i n g so u r c e b u t g e n e r a l l y i s e i t h e r 20 % o f u n i t s a t 6 0 % A M I o r 20 % o f u n i t s a t 5 0 % A M I (A H T F ) x 1 5 y e a r mi n i m u m . x N o n e . x O n l y 1 - 2 p r ad v a n t a g e si n c e 2 0 0 2 x Cu r r e n t l y e bo n u s a n d p a r k i n g n i n c e n t i v e A a s s i s t e d r e n t a l s me o w n e r s h i p . ev e l o p m e n t i n z o n e s – d e n s i t y nc e n t i v e x R e n t a l s – 3 0 % o f u n i t s af f o r d a b l e t o h o u s e h o l d s ea r n i n g 6 0 % A M I , o f w h i c h a t le a s t o n e t h i r d w i l l b e af f o r d a b l e t o 5 0 % A M I , a n d a t le a s t o n e t h i r d w i l l a f f o r d a b l e t o 30 % A M I . x R e n t a l - 1 0 ye a r mi n i m u m . x D e v e l o p m e n t A g r e e m e n t x V o l u n t a r y / no t b e i n g u be i n g r e v i s is t a n c e ry / i n c e n t i v e b a s e d f o r op m e n t s . x R e n t a l s – 1 0 % o f u n i t s a t 5 0 % AM I f o r a l l d e v e l o p m e n t s , 2 0 % of u n i t s a t 5 0 % A M I i f u s i n g TI F f u n d i n g . x 3 0 y e a r mi n i m u m . x C o n s i d e r e d o n a c a s e b y c a s e ba s i s . x D e v e l o p m e n t A g r e e m e n t . x P r o d u c e d si n c e 2 0 0 4 is t a n c e vo l u n t a r y / i n c e n t i v e pp r o a c h f o r a l l me n t s ; e x p l o r i n g g a p o l i c y . x C i t y s u b s i d y – 2 0 % o f u n i t s a t 50 % A M I . x V o l u n t a r y / i n c e n t i v e – st a r t s a t 10 % o f u n i t s a t 5 0 % A M I . ry / i n c e n t i v e b a s e d – bo n u s p o l i c y x 2 0 % o f u n i t s a t 8 0 % A M I o r ne g o t i a t e d . x 1 5 y e a r mi n i m u m . lo p m e n t s t h a t n e e d ro v a l x 3 0 % o f u n i t s a t 8 0 % A M I . ry / i n c e n t i v e b a s e d – bo n u s p o l i c y x N e g o t i a b l e x 1 5 % d e n s re q u i r e m e mb e r o f Un i t s nu m b e r o f va c a n t u n i t s Re n t f o r a st u d i o Re n t f o r a 1 be d r o o m Re n t f o r a 2 be d r o o m Re n t f o r a 3 b e d r o o m Re n t f o r a 4 be d r o o m Do y o u a c c e p t se c t i o n 8 Ha s r e n t in c r e a s e d ov e r t h e pa s t 2y e a r s ? Ho w m u c h ha s r e n t in c r e a s e d ? Mo s t 12 0 75 0 80 0 no n e w ye s $1 5 - 5 0 12 0 0 Av e : $ 7 5 0 Av e $ 8 5 0 Ye s ye s 8% 10 0 84 5 - 9 5 0 ye s no 36 0 75 5 92 9 10 7 5 no ye s 5% e a c h mo n t h 24 0 $8 9 5 1 f l - $ 1 0 2 5 , 2 - 3 f l $1 0 7 5 Ye s ( T y p i c a l l y do n ’ t m e e t cr i t e r i a ) ye s 10 0 - 2 b d - 1b d 7 5 sm o k 90 0 ga r d e n - $ 7 5 0 2 - 3 f l o o r $ 8 0 0 ye s ye s $2 0 po l i c e 12 8 0 $7 3 5 $8 3 5 - 8 5 5 $9 4 5 - 9 7 5 no ye s $5 0 d 12 2 3 f o r e n d o f ma r c h $7 5 5 $9 3 5 ye s ye s 50 no n - 81 4 ( 0 i n p a s t fe w y e a r s ) 11 8 1 - 1 2 7 5 (1 b d + d e n 10 8 1 11 9 0 - 1 7 5 0 No ( i n h e r i t e d ) ye s 2- 5 % 65 11 5 0 12 0 1 84 5 - 9 2 0 10 1 0 - 1 9 0 No n e w o n e s ye s 3% i n c r e a s e 18 0 73 7 87 0 ye s no 25 2 3 77 5 85 0 - 8 7 5 - 8 9 5 99 5 - 1 0 4 5 no ye s 50 la t 72 0 84 9 94 9 11 3 9 ye s ye s 34 - 5 5 54 0 84 9 94 9 11 3 9 no ye s 34 - 5 5 36 1 75 0 90 0 - 9 9 5 no ye s 75 - 9 5 50 0 89 5 - 9 2 5 10 5 0 - 1 1 9 0 ye s Ye s 2- 4 % 21 7 0 91 9 - 9 4 9 11 2 9 - 1 1 5 9 11 5 9 - 1 1 8 9 2 b d + 1 . 5 b a 12 0 9 - 1 2 4 9 2b d + 2 b a no ye s 10 0 12 8 0 90 0 97 5 - 1 0 0 0 12 5 0 ye s ye s 50 - 7 5 84 2 92 9 99 9 - 1 0 5 0 no ye s 40 22 1 80 0 80 0 - 1 0 0 0 ye s ye s 75 36 3 70 0 80 0 - 8 5 0 11 5 0 - 1 2 0 0 ye s ye s $5 0 no 27 6 3 95 0 + 11 0 5 - 1 2 2 5 + ye s ye s 5% 11 2 2 90 4 - 9 0 9 97 0 ye s ye s 30 nu m b e r o f va c a n t u n i t s Re n t f o r a st u d i o Re n t f o r a 1 be d r o o m Re n t f o r a 2 b e d r o o m Re n t f o r a 3 be d r o o m Re n t f o r a 4 b e d r o o m Re n t f o r a 5 be d r o o m Do y o u a c c e p t se c t i o n 8 Ha s r e n t in c r e a s e d ov e r t h e pa s t 2y e a r s ? Ho w m u c h ha s r e n t in c r e a s e d ? Mo s t c 0 10 5 0 12 5 0 14 5 0 15 5 0 ye s ye s 2- 3 % 13 0 0 14 0 0 15 0 0 Ye s 1 13 5 0 no ye s 50 0 12 3 5 - 1 3 2 5 14 1 0 - 1 4 5 0 no no no n - p a 0 11 5 0 no no 0 11 7 0 - 1 2 5 0 ye s no no n 0 10 0 0 12 0 0 no ye s 5% 13 5 0 - 2 0 0 0 no no 0 85 0 - 9 5 0 ye s no n                                              !     "  #"   $    %  $      !                     &      "  $    #" %  &      &            &  $  & $               ' !   "   (     $ ) $    &  *$  **                  (     $ ) $    &    **                  # $                   !" "" #$%"& '(  )$ %%#*$"#$%""+,,-#--  ,-#).#$%".&) &&"%+,&,)&"%$%/&0+. %%1)# .!$ $#.2,%%&)))3,)$03"$%&$)+,&, +&4 .5, . 12,"".$./&,'& '-# %/&.& $$&.6 )&1+,&,), ).)&2,)3 ,)$3"$%&$ "".$,+)3,,%&$)781 11)# 9+,&,)%#$+.5 &$ .., 6 )&2,,.&%.% &,),%%,",6 )&+))5$),. ,+#,%%+).&.,+."#3+.+,,)$2 )33,#)& 5&&+,,,"+)+,,#+.&.+$$)))$$,%%2,..3 ,)3 ,%&$3&& )+ $.33&,$ 3,).%%)$2  ,#"51     &$",-#),.,&&%3,)+,&,&$ .. 3 0) 0 0 " $03"$.#$%"2,5 $.+ $.,#":3 );)3") .) % ,5." )2,%%)":3 . ..) 3&%!3)$$% 5."2  ,%. &,%%)+ $.5".0"!0%. &+,)33.5$,) "!< =0 =3,".&"2,&$$>5$, )>.+ $.5)"$, +!3&, ).#$%") .,2,.#$%,)) 5".%/&#+,&, .)&5),&&%,&%.).,+),%".$2  ,.#$%) 5".$%3"+,&,.&)$%/&&)3%%:"$?<  2 ,%3".&),,+$$5%,3&.,.#$%&%)%%$3% 5$& ) 5)."!,%/&3)5$2,%/&)%%).+ $.",33.5$4 ")3 , )6 .)&+,&,),%36 .)&,,%%& $)24 )3% 5$& ) 5).+ $., ,, @)3"$#+%&))&$ .#+5, @)% 5$&3& &) $2  3#+,&&%%%)$,   &$.&.%)),%/&2,.#$%) +4 )*$"#$%""$$+,""&. &#+3,%% 53&3,%/&%%%%%%$)5&)) %%#$)3, .#$%".+,,"3,)$3,*%2,*$" #$%""+ $.:%( $8  A2  ,:)%+ $.53,.#$%) 5"%%$&3% 5$&) 5).+,&,+ $., .@)3"$#+%&))2,..#$%+$$$).% &,) "3,%%+,&,+ $.$)4 % 5$&,.%%#$3",% :& 2  &).,)"2     ..#$%" &RPPLVVLRQHU     LQWURGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  ('$5(62/87,2112  5(62/87,21 $33529,1* $ 35(/,0,1$5< '(9(/230(17 $*5((0(17:,7+7+25/,9,1*//&  :+(5($6WKH(FRQRPLF'HYHORSPHQW$XWKRULW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH³$XWKRULW\´ KDVUHFHLYHGDSURSRVDOIURP7KRU/LYLQJ//&D0LQQHVRWDOLPLWHGOLDELOLW\ FRPSDQ\ WKH³'HYHORSHU´ UHJDUGLQJWKHGHYHORSPHQWRIODQGRZQHGE\WKH$XWKRULW\IRUWKH FUHDWLRQRIDPXOWLIDPLO\ZRUNIRUFHKRXVLQJDSDUWPHQWEXLOGLQJZKLFKSURSRVDOFRQWHPSODWHVWKH $XWKRULW\¶VFRQYH\DQFHRIWKH$XWKRULW\3URSHUW\WRWKH'HYHORSHUDQG  :+(5($6WKH$XWKRULW\¶V%RDUGRI&RPPLVVLRQHUVKDVUHYLHZHGWKH'HYHORSHU V GHYHORSPHQWFRQFHSWDQGKDVFDXVHGWREHSUHSDUHGD3UHOLPLQDU\'HYHORSPHQW$JUHHPHQWWR DOORZWKH'HYHORSHUWRQHJRWLDWHWKHSXUFKDVHRIWKH$XWKRULW\3URSHUW\FRQGXFWGXHGLOLJHQFH REWDLQWKHQHFHVVDU\ILQDQFLQJDQGFRPPLWPHQWVWRFRQVWUXFWWKHGHYHORSPHQWDSSO\IRUDQGJDLQ DSSURYDOIURPWKH&LW\IRUWKHGHYHORSPHQWDQGDQ\QHFHVVDU\SXEOLFVXEVLG\DQG   12: 7+(5()25( %( ,7 5(62/9(' E\ WKH %RDUG RI &RPPLVVLRQHUV RI WKH (FRQRPLF'HYHORSPHQW$XWKRULW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH³%RDUG DVIROORZV   7KH ('$KHUHE\ DSSURYHVWKH3UHOLPLQDU\'HYHORSPHQW $JUHHPHQWVXEVWDQWLDOO\LQ DFFRUGDQFHZLWKWKHWHUPVVHWIRUWKLQWKHIRUPSUHVHQWHGWRWKH%RDUGWRJHWKHUZLWKDQ\UHODWHG GRFXPHQWV QHFHVVDU\ LQ FRQQHFWLRQ WKHUHZLWK FROOHFWLYHO\ WKH3UHOLPLQDU\ 'HYHORSPHQW 'RFXPHQWV DQGKHUHE\DXWKRUL]HVWKH3UHVLGHQWDQG([HFXWLYH'LUHFWRUWRQHJRWLDWHWKHILQDO WHUPVWKHUHRIDQGLQWKHLUGLVFUHWLRQDQGDWVXFKWLPHDVWKH\PD\GHHPDSSURSULDWHWRH[HFXWHWKH 3UHOLPLQDU\'HYHORSPHQW'RFXPHQWVRQEHKDOIRIWKH$XWKRULW\DQGWRFDUU\RXWRQEHKDOIRIWKH $XWKRULW\WKH$XWKRULW\¶VREOLJDWLRQVWKHUHXQGHU    7KH DSSURYDO KHUHE\ JLYHQ WR WKH 3UHOLPLQDU\ 'HYHORSPHQW 'RFXPHQWV LQFOXGHV DSSURYDO RI VXFK DGGLWLRQDO GHWDLOV WKHUHLQ DV PD\ EH QHFHVVDU\ DQG DSSURSULDWH DQG VXFK PRGLILFDWLRQV WKHUHRI GHOHWLRQV WKHUHIURP DQG DGGLWLRQV WKHUHWR DV PD\ EH QHFHVVDU\ DQG DSSURSULDWHDQGDSSURYHGE\OHJDOFRXQVHOWRWKH$XWKRULW\DQGE\WKHRIILFHUVDXWKRUL]HGKHUHLQWR H[HFXWHVDLGGRFXPHQWVSULRUWRWKHLUH[HFXWLRQDQGVDLGRIILFHUVDUHKHUHE\DXWKRUL]HGWRDSSURYH VDLG FKDQJHV RQ EHKDOI RI WKH $XWKRULW\ 7KH H[HFXWLRQ RI DQ\ LQVWUXPHQW E\ WKH DSSURSULDWH RIILFHUV RI WKH $XWKRULW\ KHUHLQ DXWKRUL]HG VKDOO FRQFOXVLYH HYLGHQFH RI WKH DSSURYDO RI VXFK GRFXPHQWLQDFFRUGDQFHZLWKWKHWHUPVKHUHRI,QWKHHYHQWRIDEVHQFHRUGLVDELOLW\RIWKHRIILFHUV DQ\ RI WKH GRFXPHQWV DXWKRUL]HGE\ WKLV 5HVROXWLRQWREH H[HFXWHG PD\EH H[HFXWHG ZLWKRXW IXUWKHUDFWRUDXWKRUL]DWLRQRIWKH%RDUGE\DQ\GXO\GHVLJQDWHGDFWLQJRIILFLDORUE\VXFKRWKHU RIILFHURURIILFHUVRIWKH%RDUGDVLQWKHRSLQLRQRIWKH&LW\$WWRUQH\PD\DFWLQWKHLUEHKDOI   8SRQH[HFXWLRQDQGGHOLYHU\RIWKH3UHOLPLQDU\'HYHORSPHQW'RFXPHQWVWKHRIILFHUV DQGHPSOR\HHVRIWKH$XWKRULW\DUHKHUHE\DXWKRUL]HGDQGGLUHFWHGWRWDNHRUFDXVHWREHWDNHQ VXFK DFWLRQV DV PD\ EH QHFHVVDU\ RQ EHKDOI RI WKH $XWKRULW\ WRLPSOHPHQW WKH 3UHOLPLQDU\ 'HYHORSPHQW'RFXPHQWV  5HVROXWLRQ1R   7KH%RDUGKHUHE\GHWHUPLQHVWKDWWKHH[HFXWLRQDQGSHUIRUPDQFHRIWKH3UHOLPLQDU\ 'HYHORSPHQW'RFXPHQWVZLOOKHOSUHDOL]HWKHSXEOLFSXUSRVHVRIWKH$FW       'HFHPEHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\FRPPLVVLRQHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG    Y 35(/,0,1$5<'(9(/230(17$*5((0(17   35(/,0,1$5<'(9(/230(17$*5((0(17GDWHGWKLVWKGD\RI'HFHPEHU E\DQGEHWZHHQWKH(FRQRPLF'HYHORSPHQW$XWKRULW\RI%URRNO\Q&HQWHU6KLQJOH &UHHN3DUNZD\%URRNO\Q&HQWHU01 WKH³$XWKRULW\´ DQG7KRU/LYLQJ//& 3HQQ$YH1RUWK6XLWH0LQQHDSROLV01 WKH³'HYHORSHU´   :+(5($6WKH$XWKRULW\LVWKHIHHRZQHURISURSHUW\ORFDWHGLQWKH&LW\RI%URRNO\Q &HQWHU WKH³&LW\´ DW%URRNO\Q%OYGDQGVW$YH1RUWK WKH³3URSHUW\´  ZKLFK3URSHUW\WKH$XWKRULW\LVZLOOLQJWRFRQVLGHUVHOOLQJIRUSXUSRVHVRIGHYHORSPHQWRIDQ DSSUR[LPDWHO\  XQLW PXOWLIDPLO\ ZRUNIRUFH KRXVLQJ DSDUWPHQW EXLOGLQJ WKH ³'HYHORSPHQW´   :+(5($6WKH'HYHORSHUGHVLUHVWRH[SORUHWKHSRVVLELOLW\RIDFTXLULQJWKH3URSHUW\ WRJHWKHUZLWKDGGLWLRQDODGMRLQLQJSULYDWHSURSHUW\ ³$GGLWLRQDO3URSHUW\´ WRFRPELQHZLWKWKH 3URSHUW\ WRJHWKHU WKH ³3URSHUW\´ DQG ³$GGLWLRQDO 3URSHUW\´ DUH UHIHUUHG WR KHUHLQ DV WKH ³'HYHORSPHQW3URSHUW\´ IRUGHYHORSPHQWRIWKH'HYHORSPHQW  :+(5($6WKH$XWKRULW\¶V%RDUGRI&RPPLVVLRQHUVKDVUHYLHZHGWKH'HYHORSPHQW FRQFHSWDQGLVLQWHUHVWHGLQGHYHORSPHQWRIWKH3URSHUW\DVSURSRVHGE\WKH'HYHORSHU  :+(5($6LIWKH'HYHORSHULVVXFFHVVIXOLQ REWDLQLQJWKHQHFHVVDU\ILQDQFLQJ DQG FRPPLWPHQWVWRFRQVWUXFWWKH'HYHORSPHQWDQGDJUHHVWRFRQVWUXFWWKH'HYHORSPHQWWKHQWKH $XWKRULW\ZRXOGEHZLOOLQJWRHQWHULQWRDQDJUHHPHQWZLWKWKH'HYHORSHUIRUWKHFRQYH\DQFHRI WKH3URSHUW\DQGFRQVWUXFWLRQRIWKH'HYHORSPHQWDWDPXWXDOO\DJUHHGXSRQSULFHWRJHWKHUZLWK RWKHUQHJRWLDWHGFRQGLWLRQVIRUFRQYH\DQFHRIWKH'HYHORSPHQW3URSHUW\  :+(5($6 'HYHORSHU KDV UHTXHVWHG WKDW WKH $XWKRULW\ H[HFXWH WKLV 3UHOLPLQDU\ 'HYHORSPHQW $JUHHPHQW ³3'$´  DJUHHLQJ WR ZRUN VROHO\ ZLWK 'HYHORSHU GXULQJ WKH WHUP KHUHRIRQQHJRWLDWLRQVIRUDFTXLVLWLRQRIWKH'HYHORSPHQW3URSHUW\E\'HYHORSHUWRSURYLGH 'HYHORSHUZLWKWLPHWRFRQGXFWUHYLHZRIWKH'HYHORSPHQW3URSHUW\REWDLQILQDQFLQJIRUWKH SURSRVHG 'HYHORSPHQW SUHSDUH DSSURSULDWH SODQV IRU WKH 3URSHUW \ REWDLQ QHFHVVDU\ &LW\ DSSURYDOVIRUWKH'HYHORSPHQWDQGQHJRWLDWHZLWKWKH$XWKRULW\RQDQDJUHHPHQWIRUWKHVDOHRI WKH'HYHORSPHQW3URSHUW\  :+(5($6WKH$XWKRULW\LVZLOOLQJWRHQWHULQWRWKLV3'$IRUVXFKSXUSRVHVXSRQWKH WHUPVDQGFRQGLWLRQVSURYLGHGKHUHLQ 12:7+(5()25(WKHSDUWLHVDJUHHDVIROORZV   ,QFRQVLGHUDWLRQRIWKHSURFHVVLQJRIWKH'HYHORSPHQWXQGHUWKHWHUPVRIWKLV 3'$WKH$XWKRULW\DJUHHVWKDWLWZLOOQHJRWLDWHDQGZRUNVROHO\ZLWK'HYHORSHURQQHJRWLDWLRQV IRUVDOHRIWKH3URSHUW\WR'HYHORSHUIRU'HYHORSHU¶VSURSRVHG'HYHORSPHQWXQWLO-XO\ ³7HUP´    'XULQJWKH7HUPRIWKLV3'$'HYHORSHUDJUHHVWRXVHLWVEHVWHIIRUWVWR  Y  L  FRPSOHWHVLWHSODQQLQJDQGVLWHHQJLQHHULQJ LL  FRPSOHWHDUFKLWHFWXUDOFRQFHSWSODQV LLL  VXEPLW DSSOLFDWLRQ IRU D 3XEOLF 6XEVLG\ UHTXHVW DQG DOO QHFHVVDU\ ILQDQFLDO GRFXPHQWDWLRQQHHGHGIRUUHYLHZ LY  VXEPLW DSSOLFDWLRQ DQG UHFHLYH DOO QHFHVVDU\ &LW\ DSSURYDOV UHODWHG WR WKH VXEGLYLVLRQDQGGHYHORSPHQWRIWKH'HYHORSPHQW3URSHUW\ Y  VHFXUHFRQVWUXFWLRQILQDQFLQJQHFHVVDU\WRFRQVWUXFWDSURMHFWFRQVLVWHQWZLWKWKH WHUPVRIWKLV3'$  YL  QHJRWLDWHD&RQWUDFWIRU3ULYDWH'HYHORSPHQWIRUDFTXLVLWLRQDQGGHYHORSPHQWRI WKH'HYHORSPHQW3URSHUW\DQGFRQVWUXFWLRQRIDQDSSURYHG'HYHORSPHQW   'XULQJWKH7HUPRIWKLV3'$'HYHORSHUDQGWKH$XWKRULW\DJUHHWRXVHWKHLUEHVW HIIRUWVWRUHVROYHSURSHUW\DFTXLVLWLRQLVVXHVUHODWHGWRWKH'HYHORSPHQW3URSHUW\DQGWRDWWHPSW WREULQJIUXLWLRQWRWKHSURSRVHG'HYHORSPHQWWKURXJKD&RQWUDFWIRU3ULYDWH'HYHORSPHQWIRU FRQYH\DQFHRIWKH3URSHUW\DQGGHYHORSPHQWRIWKH'HYHORSPHQW3URSHUW\SURYLGHGKRZHYHU WKDW WKH 'HYHORSHU DFNQRZOHGJHV WKDW WKH $XWKRULW\ ZLOO QRW H[HUFLVH WKH SRZHU RI HPLQHQW GRPDLQZLWKUHVSHFWWRWKHDFTXLVLWLRQRIDQ\SURSHUW\LQFRQQHFWLRQZLWKWKH'HYHORSPHQWRU WKLV3'$   'HYHORSHUPD\DVVLJQWKLV3'$WRDQDIILOLDWHRU$XWKRULW\DSSURYHGVXFFHVVRU XSRQZULWWHQQRWLILFDWLRQDQGDSSURYDOE\WKH&LW\   7KH'HYHORSHUZLOOSURYLGHWKH&LW\ZLWKDZULWWHQSURJUHVVUHSRUWRQWKHVWDWXVRI WKHJRDOVLGHQWLILHGLQ3DUDJUDSKVDQGHYHU\GD\VIROORZLQJWKHGDWHRIWKLV3'$   7KLV 3'$ UHSUHVHQWV WKH HQWLUH XQGHUVWDQGLQJ RI WKH SDUWLHV UHJDUGLQJ WKH 'HYHORSPHQW$UHDDQGDQ\DPHQGPHQWWRWKLV3'$VKDOOEHLQZULWLQJDQGEHH[HFXWHGE\ERWK SDUWLHV  %RWK 3DUWLHV DUH DZDUH RI DQG DFNQRZOHGJH WKDW FRQWLQJHQFLHV DQG XQNQRZQV SUHVHQWO\H[LVWDQ\RQHRUPRUHRIZKLFKFRXOGPDNHWKH'HYHORSPHQWFRVWSURKLELWLYHDQGWKDW ERWKSDUWLHVDUHH[SHQGLQJVXPVRIPRQH\DQGWLPHZLWKIXOONQRZOHGJHRIWKHULVNVLQYROYHG DQGWKDWQHLWKHUSDUW\VKDOOEHOLDEOHIRUDQ\RIWKHRWKHUSDUW\¶VH[SHQVHVLQDQ\HYHQWH[FHSW L  DVRWKHUZLVHSURYLGHGSXUVXDQWWRDVHSDUDWHDJUHHPHQWEHWZHHQWKHSDUWLHV LL LQFRQQHFWLRQ ZLWKDQDSSOLFDWLRQIRUD3XEOLF6XEVLG\RU LLL SXUVXDQWWRUHTXLUHGIHHVRUFRVWVUHODWHGWR DSSOLFDWLRQVPDGHWRWKH&LW\RUXQGHU&LW\&RGH  7KHSDUWLHVDJUHHWKDWWKLV3'$LVQRWLQWHQGHGWRELQGWKHSDUWLHVWRHQWHULQWRDQ DJUHHPHQWIRUWKHVDOHDQGDFTXLVLWLRQRIWKH3URSHUW\EXWLVPHUHO\LQWHQGHGWRVHWIRUWKWKH SDUWLHV¶LQWHQWWRSURFHHGZLWKWKHSURFHVVRI L QHJRWLDWLQJDQDJUHHPHQWIRUWKHVDOHRIWKH 'HYHORSPHQW3URSHUW\DQGGHYHORSPHQWRIWKH'HYHORSPHQW3URSHUW\DQG LL UHVROYLQJFHUWDLQ SUHGHYHORSPHQWLVVXHVUHODWHGWRWKH'HYHORSPHQW3URSHUW\DQG'HYHORSPHQW   1RDSSURYDOJLYHQE\WKH$XWKRULW\KHUHXQGHURULQFRQQHFWLRQKHUHZLWKVKDOOEH GHHPHGWRFRQVWLWXWHDQDSSURYDORIWKH'HYHORSPHQWIRUDQ\SXUSRVHRWKHUWKDQDVVWDWHGKHUHLQ DQGWKHSURFHVVRXWOLQHGLQWKLV$JUHHPHQWVKDOOQRWEHGHHPHGWRVXSHUVHGHDQ\FRQFHSWUHYLHZ  Y FRQGLWLRQDOXVHSHUPLWYDFDWLRQVXEGLYLVLRQRURWKHU]RQLQJRUSODQQLQJDSSURYDOSURFHVVRIWKH $XWKRULW\RUWKH&LW\UHODWLYHWRWKHGHYHORSPHQWRIUHDOHVWDWH   7KLV3'$PD\EHDPHQGHGE\PXWXDOZULWWHQDJUHHPHQWRIWKHSDUWLHV   ,I DQ\ SRUWLRQ RI WKLV $JUHHPHQW LV KHOG LQYDOLG E\ D FRXUW RI FRPSHWHQW MXULVGLFWLRQ VXFK GHFLVLRQ VKDOO QRW DIIHFW WKH YDOLGLW\ RI DQ\ UHPDLQLQJ SRUWLRQ RI WKLV $JUHHPHQW   1RWLFHGHPDQGRURWKHUFRPPXQLFDWLRQIURPRQHSDUW\WRWKHRWKHUVKDOOEH GHHPHGHIIHFWLYHLIVHQWE\FHUWLILHGPDLOSRVWDJHSUHSDLGUHWXUQUHFHLSWUHTXHVWHGRUGHOLYHUHG SHUVRQDOO\WRDSDUW\DWLWVDGGUHVVLQWKHILUVWSDUDJUDSKRIWKLV$JUHHPHQWRUDWVXFKRWKHU DGGUHVVDVVXFKSDUW\PD\GHVLJQDWHLQZULWLQJWRWKHRWKHUSDUW\   7KH $XWKRULW\ DQG 'HYHORSHU DJUHH WKDW WKLV $JUHHPHQW LV LQWHQGHG WR EH SUHOLPLQDU\ LQ QDWXUH DQG ZLOO EH VXSHUVHGHG E\ RQH RU PRUH GHILQLWLYH FRQWUDFWV PXWXDOO\ VDWLVIDFWRU\ WR WKH $XWKRULW\ DQG WKH 'HYHORSHU ZKLFK VKDOO EH QHJRWLDWHG DSSURYHG DQG H[HFXWHGE\WKH$XWKRULW\DQGWKH'HYHORSHUDQGQRREOLJDWLRQUHJDUGLQJWKHFRQYH\DQFHRI SURSHUW\RUSURYLVLRQRIDQ\3XEOLF6XEVLG\VKDOOH[LVWZLWKUHVSHFWWRWKH'HYHORSPHQWSULRUWKH DSSURYDODQGH[HFXWLRQRIVXFKGHILQLWLYHFRQWUDFW V   ,1 :,71(66 :+(5(2) WKH $XWKRULW\ KDV FDXVHG WKLV $JUHHPHQW WR EH GXO\ H[HFXWHG LQ LWV QDPH DQG EHKDOI DQG WKH 'HYHORSHU KDV FDXVHG WKLV $JUHHPHQW WR EH GXO\ H[HFXWHGLQLWVQDPHDQGEHKDOIRQRUDVRIWKHGDWHILUVWDERYHZULWWHQ   (&2120,& '(9(/230(17 $87+25,7< 2)%522./<1&(17(50,11(627$     %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB ,WV3UHVLGHQW   %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB ,WV([HFXWLYH'LUHFWRU    7KRU/LYLQJ//&   %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  ,WVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB                   !" "" #$%"& '(  )$ %%#*$"#$%""+, ")--  ,+)%%."$ &)/ 0#$%0&  )$01 ),+)/,+20 ) ,/34,# 5,%%+)&6 0 7,/,+/$0&"%$, %$00#$%"/,)7!))0005,&6 0,%%/, % %)/%)#//  )0$, )%% )5,%%+)&6 0/82  )9 :%$0, )/ 0)5,)/ 0)))0)%&/&$$7 )0&$;, 0#$%"///07$, )59///07$, )),/$ ),%%,,/ 0) +$$07%07&!,0)&5  , &7   ",   &$#+0,%%)$)/"0#$%))0 0#$%,)5,#"7:  ",   &$)$&0 ")), %/00#$%5  "),0//0+%))%/,%%)$<2 =- &%*$+,&,%%)0:2 )$/"$,")+,"" "$+0,/2 /0&%0,"#$ )/8:2 >8:2  5< 3 =- &%*$+,&,%%)0: )$/"$,")+,"" "$+0,/3 /0&%0 ,"#$ )/8::  >8:32 5 %%)0% &,)%&/8:2  /$0+,,/)% 08?  /,)&0%5  ,   &$0&0,%/0,/)%5  900,#&/)",/+ ,)0&0,,%%)$+$$6 , &6 )/00$%#%%0&&""0,+, )59/,%%)&7 &6 0,&6 )" )0//,,)"0" ,,%1&)"07 $0,$0#$ 01 )05  '//,)%%0*$"#$%"",+$$$$+ 7,0 0$& ,00$%%&6 )0%%$/%$"0/$%$/", 5, *$"#$%""+$$.%%$ 45 ,%)&"%$,%$ %&))7,0077$&""&+,&) &&#)),$,/5  % &,)"+$$070)%/,.)%)/,%&))+,&,+$$&"7&! 7/,/%%#$5,0)%)/% 7$&$0$)6 )% 7$&,7/, +,&,+$$&& %&$)0)%/,%%#$/,% &,)"5  &)0,)"5     00#$%" &RPPLVVLRQHU     LQWURGXFHG WKH IROORZLQJ UHVROXWLRQ DQG PRYHGLWVDGRSWLRQ  ('$5(62/87,2112  5(62/87,21 $33529,1* $ 35(/,0,1$5< '(9(/230(17 $*5((0(17:,7+&(175$+20(6//&  :+(5($6WKH(FRQRPLF'HYHORSPHQW$XWKRULW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH ³$XWKRULW\´  KDV UHFHLYHG D SURSRVDO IURP &HQWUD +RPHV D0LQQHVRWD OLPLWHG OLDELOLW\ FRPSDQ\ WKH³'HYHORSHU´ UHJDUGLQJWKHGHYHORSPHQWRIODQGRZQHGE\WKH$XWKRULW\IRUWKH FUHDWLRQRIDILQDOSODWFRQVWUXFWLRQRIVLQJOHIDPLO\KRPHVDQGDVVRFLDWHGSXEOLFLQIUDVWUXFWXUH LPSURYHPHQWV LQFOXGLQJ XWLOLWLHV QHZ URDGV DQG VWRUP ZDWHU SRQGLQJ ZKLFK SURSRVDO FRQWHPSODWHVWKH$XWKRULW\¶VFRQYH\DQFHRIWKH$XWKRULW\3URSHUW\WRWKH'HYHORSHUDQG  :+(5($6WKH$XWKRULW\¶V%RDUGRI&RPPLVVLRQHUVKDVUHYLHZHGWKH'HYHORSHU V GHYHORSPHQWFRQFHSWDQGKDVFDXVHGWREHSUHSDUHGD3UHOLPLQDU\'HYHORSPHQW$JUHHPHQWWR DOORZWKH'HYHORSHUWRQHJRWLDWHWKHSXUFKDVHRIWKH$XWKRULW\3URSHUW\FRQGXFWGXHGLOLJHQFH DQGJDLQDSSURYDOIURPWKH&LW\IRUDSUHOLPLQDU\DQGILQDOSODWWRVXEGLYLGHWKHSURSHUW\DQG   12: 7+(5()25( %( ,7 5(62/9(' E\ WKH %RDUG RI &RPPLVVLRQHUV RI WKH (FRQRPLF'HYHORSPHQW$XWKRULW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH³%RDUG DVIROORZV   7KH ('$KHUHE\ DSSURYHVWKH3UHOLPLQDU\'HYHORSPHQW $JUHHPHQWVXEVWDQWLDOO\LQ DFFRUGDQFHZLWKWKHWHUPVVHWIRUWKLQWKHIRUPSUHVHQWHGWRWKH%RDUGWRJHWKHUZLWKDQ\UHODWHG GRFXPHQWV QHFHVVDU\ LQ FRQQHFWLRQ WKHUHZLWK FROOHFWLYHO\ WKH3UHOLPLQDU\ 'HYHORSPHQW 'RFXPHQWV DQGKHUHE\DXWKRUL]HVWKH3UHVLGHQWDQG([HFXWLYH'LUHFWRUWRQHJRWLDWHWKHILQDO WHUPVWKHUHRIDQGLQWKHLUGLVFUHWLRQDQGDWVXFKWLPHDVWKH\PD\GHHPDSSURSULDWHWRH[HFXWHWKH 3UHOLPLQDU\'HYHORSPHQW'RFXPHQWVRQEHKDOIRIWKH$XWKRULW\DQGWRFDUU\RXWRQEHKDOIRIWKH $XWKRULW\WKH$XWKRULW\¶VREOLJDWLRQVWKHUHXQGHU    7KH DSSURYDO KHUHE\ JLYHQ WR WKH 3UHOLPLQDU\ 'HYHORSPHQW 'RFXPHQWV LQFOXGHV DSSURYDO RI VXFK DGGLWLRQDO GHWDLOV WKHUHLQ DV PD\ EH QHFHVVDU\ DQG DSSURSULDWH DQG VXFK PRGLILFDWLRQV WKHUHRI GHOHWLRQV WKHUHIURP DQG DGGLWLRQV WKHUHWR DV PD\ EH QHFHVVDU\ DQG DSSURSULDWHDQGDSSURYHGE\OHJDOFRXQVHOWRWKH$XWKRULW\DQGE\WKHRIILFHUVDXWKRUL]HGKHUHLQWR H[HFXWHVDLGGRFXPHQWVSULRUWRWKHLUH[HFXWLRQDQGVDLGRIILFHUVDUHKHUHE\DXWKRUL]HGWRDSSURYH VDLG FKDQJHV RQ EHKDOI RI WKH $XWKRULW\ 7KH H[HFXWLRQ RI DQ\ LQVWUXPHQW E\ WKH DSSURSULDWH RIILFHUV RI WKH $XWKRULW\ KHUHLQ DXWKRUL]HG VKDOO FRQFOXVLYH HYLGHQFH RI WKH DSSURYDO RI VXFK GRFXPHQWLQDFFRUGDQFHZLWKWKHWHUPVKHUHRI,QWKHHYHQWRIDEVHQFHRUGLVDELOLW\RIWKHRIILFHUV DQ\ RI WKH GRFXPHQWV DXWKRUL]HGE\ WKLV 5HVROXWLRQWREH H[HFXWHG PD\ EH H[HFXWHG ZLWKRXW IXUWKHUDFWRUDXWKRUL]DWLRQRIWKH%RDUGE\DQ\GXO\GHVLJQDWHGDFWLQJRIILFLDORUE\VXFKRWKHU RIILFHURURIILFHUVRIWKH%RDUGDVLQWKHRSLQLRQRIWKH&LW\$WWRUQH\PD\DFWLQWKHLUEHKDOI   8SRQH[HFXWLRQDQGGHOLYHU\RIWKH3UHOLPLQDU\'HYHORSPHQW'RFXPHQWVWKHRIILFHUV DQGHPSOR\HHVRIWKH$XWKRULW\DUHKHUHE\DXWKRUL]HGDQGGLUHFWHGWRWDNHRUFDXVHWREHWDNHQ VXFK DFWLRQV DV PD\ EH QHFHVVDU\ RQ EHKDOI RI WKH $XWKRULW\ WRLPSOHPHQW WKH 3UHOLPLQDU\ 'HYHORSPHQW'RFXPHQWV  5HVROXWLRQ1R   7KH%RDUGKHUHE\GHWHUPLQHVWKDWWKHH[HFXWLRQDQGSHUIRUPDQFHRIWKH3UHOLPLQDU\ 'HYHORSPHQW'RFXPHQWVZLOOKHOSUHDOL]HWKHSXEOLFSXUSRVHVRIWKH$FW       'HFHPEHU    ' D W H   0 D \ R U    $77(67          & L W \  & O H U N   7KHPRWLRQIRUWKHDGRSWLRQRIWKHIRUHJRLQJUHVROXWLRQZDVGXO\VHFRQGHGE\FRPPLVVLRQHU  DQGXSRQYRWHEHLQJWDNHQWKHUHRQWKHIROORZLQJYRWHGLQIDYRUWKHUHRI  DQGWKHIROORZLQJYRWHGDJDLQVWWKHVDPH ZKHUHXSRQVDLGUHVROXWLRQZDVGHFODUHGGXO\SDVVHGDQGDGRSWHG    Y7-*%5 35(/,0,1$5<'(9(/230(17$*5((0(17   7+,635(/,0,1$5<'(9(/230(17$*5((0(17 ³$JUHHPHQW´ LVPDGHDQG HQWHUHG LQWR WKLV WK GD\ RI 'HFHPEHU  E\ DQG EHWZHHQ WKH (FRQRPLF 'HYHORSPHQW $XWKRULW\RI%URRNO\Q&HQWHU0LQQHVRWD WKH³$XWKRULW\´ ZLWKLWVSULQFLSDORIILFHDW 6KLQJOH &UHHN 3DUNZD\ %URRNO\Q &HQWHU 0LQQHVRWD  DQG &HQWUD +RPHV //& D 0LQQHVRWD OLPLWHG OLDELOLW\ FRPSDQ\ WKH ³'HYHORSHU´  ZLWK LWV SULQFLSDO RIILFH DW  5RELQVRQ'U1:&RRQ5DSLGV017KH$XWKRULW\DQGWKH'HYHORSHUPD\KHUHLQDIWHU EHUHIHUUHGWRLQGLYLGXDOO\DVD³SDUW\´DQGFROOHFWLYHO\DVWKH³SDUWLHV´  :+(5($6WKH$XWKRULW\LVWKHRZQHURIFHUWDLQUHDOSURSHUW\GHVFULEHGLQ([KLELW$ WKH³$XWKRULW\3URSHUW\´ ORFDWHGLQWKH&LW\RI%URRNO\Q&HQWHU WKH³&LW\´ DQG  :+(5($6WKH'HYHORSHUKDVSUHVHQWHGWRWKH$XWKRULW\DFRQFHSWIRUWKHGHYHORSPHQW R I W K H $ X W K R U L W \ 3 U R S H U W \ D Q G F H U W D L Q R W K H U U H D O S U R S H U W \ O R F D WHG DGMDFHQW WR WKH $XWKRULW\ 3URSHUW\WKDWPD\EHDFTXLUHGE\WKH'HYHORSHU WKH³$GGLWLRQDO3URSHUW\´ IRUWKHFUHDWLRQRI D ILQDO SODW FRQVWUXFWLRQ RI VLQJOH IDPLO\ KRPHV ZLWK DQWLFLSDWHG VDOH SULFHV EHWZHHQ DQGDVVRFLDWHGSXEOLFLQIUDVWUXFWXUHLPSURYHPHQWVLQFOXGLQJXWLOLWLHVQHZ URDGV DQG VWRUP ZDWHU SRQGLQJ WKH ³'HYHORSPHQW´  ZKLFK SURSRVDO FRQWHPSODWHV WKH $XWKRULW\¶V FRQYH\DQFH RI WKH $XWKRULW\ 3URSHUW\ WR WKH 'HYHORSHU  7KH 'HYHORSHU KDV DOORFDWHGIRUWKHSXUFKDVHRIERWKWKH$XWKRULW\3URSHUW\DQG$GGLWLRQDO3URSHUW\DQG  :+(5($6WKH$XWKRULW\3URSHUW\DQGWKH$GGLWLRQDO3URSHUW\DUHFROOHFWLYHO\UHIHUUHG WRLQWKLV$JUHHPHQWDVWKH³'HYHORSPHQW3URSHUW\´DQG  :+(5($6 WKH $XWKRULW\¶V %RDUG RI &RPPLVVLRQHUV KDV UHYLHZHG WKH 'HYHORSHU V GHYHORSPHQWFRQFHSWDQGGHVLUHVWRHQWHULQWRWKLV3UHOLPLQDU\'HYHORSPHQW$JUHHPHQWWRDOORZ WKH'HYHORSHUWRQHJRWLDWHWKHSXUFKDVHRIWKH$XWKRULW\3URSHUW\FRQGXFWGXHGLOLJHQFHDQG JDLQDSSURYDOIURPWKH&LW\IRUDSUHOLPLQDU\DQGILQDOSODWWRVXEGLYLGHWKHSURSHUW\DQG  :+(5($6WKH$XWKRULW\DQG'HYHORSHULQWHQGWRSURFHHGZLWKWKH'HYHORSPHQWLI L D VDWLVIDFWRU\DJUHHPHQWFDQEHUHDFKHGUHJDUGLQJWKHSXUFKDVHSULFHWREHSDLGE\WKH'HYHORSHU IRU WKH $XWKRULW\ 3URSHUW\ LL  WKH 'HYHORSHU VXFFHVVIXOO\ QHJRWLDWHV WKH SXUFKDVH RI DQ\ QHFHVVDU\$GGLWLRQDO3URSHUW\ LLL VDWLVIDFWRU\ILQDQFLQJIRUWKH'HYHORSPHQWFDQEHVHFXUHG DQG LY WKH&LW\DSSURYHVDSUHOLPLQDU\DQGILQDOSODWWRVXEGLYLGHWKHSURSHUW\DOORZLQJWKH 'HYHORSPHQWWRSURFHHG  12:7+(5()25(LQFRQVLGHUDWLRQRIWKHIRUHJRLQJWKH$XWKRULW\DQGWKH'HYHORSHU KHUHE\DJUHHDVIROORZV   6HFWLRQ3UHOLPLQDU\1DWXUHRI$JUHHPHQW7KH$XWKRULW\DQG'HYHORSHUDJUHHWKDWWKLV $JUHHPHQWLVLQWHQGHGWREHSUHOLPLQDU\LQQDWXUH%HIRUHWKH$XWKRULW\DQG'HYHORSHUFDQ PDNHDGHFLVLRQRQZKHWKHUWRSURFHHGZLWKWKHLPSOHPHQWDWLRQRIWKH'HYHORSPHQWLWZLOOEH QHFHVVDU\WRDVVHPEOH$GGLWLRQDO3URSHUW\DQGFRQVLGHULQIRUPDWLRQUHODWLYHWRWKHXVHVGHVLJQ HFRQRPLFVDQGRWKHUDVSHFWVRIWKH'HYHORSPHQW7KHSXUSRVHRIWKLV$JUHHPHQWLVWRDOORZWKH  Y7-*%5 'HYHORSHUDQRSSRUWXQLW\WRDVVHPEOHVXFKQHFHVVDU\LQIRUPDWLRQWRUHILQHWKHDERYHUHIHUHQFHG GHYHORSPHQWFRQFHSWWRQHJRWLDWHZLWKWKH$XWKRULW\FRQFHUQLQJWKHH[HFXWLRQRIDSXUFKDVH DJUHHPHQWDQGVXEGLYLVLRQDJUHHPHQW FROOHFWLYHO\WKH³&RQWUDFWV´ DQGZKLFKLIH[HFXWHG ZLOOVHWIRUWKWKHULJKWVDQGUHVSRQVLELOLWLHVRIWKH$XWKRULW\DQGWKH'HYHORSHUZLWKUHVSHFWWRWKH 'HYHORSPHQW  'XULQJWKHWHUPRIWKLV$JUHHPHQWWKH$XWKRULW\DJUHHVWKDWLWZLOOQRW L GLVFXVVWKHWHUPVRI WKH'HYHORSPHQWZLWKDWKLUGSDUW\ZLWKRXWWKHSULRUZULWWHQFRQVHQWRI'HYHORSHUH[FHSWWRWKH H[WHQWUHTXLUHGE\WKH0LQQHVRWD*RYHUQPHQW'DWD3UDFWLFHV$FW 0LQQHVRWD6WDWXWHV&KDSWHU  RURWKHUODZRU LL HQWHULQWRRUQHJRWLDWHDVLPLODUDJUHHPHQWRUDQ\RWKHUSURSRVDOVZLWK DQ\SDUW\RWKHUWKDQWKH'HYHORSHUWRGHYHORSWKH$XWKRULW\3URSHUW\   6HFWLRQ3UHVHQW,QWHQWRI3DUWLHV7KHSDUWLHVLQWHQGWKLV$JUHHPHQWWRGRFXPHQWWKHLU SUHVHQWXQGHUVWDQGLQJDQGFRPPLWPHQWVDQGIXUWKHUWKDWLIWKHIROORZLQJFRQGLWLRQVDUHIXOILOOHG WRWKHPXWXDOVDWLVIDFWLRQRIWKH$XWKRULW\DQG'HYHORSHUWKHSDUWLHVZLOOSURFHHGLQDQDWWHPSWWR IRUPXODWHDPXWXDOO\VDWLVIDFWRU\3XUFKDVH$JUHHPHQWIRUWKH$XWKRULW\3URSHUW\   D  WKH'HYHORSHUGHPRQVWUDWHVWKHIHDVLELOLW\RIWKH'HYHORSPHQWDVUHILQHGSXUVXDQW WRWKLV$JUHHPHQW    E  WKHFRPSOHWLRQRIDOOXQGHUWDNLQJVUHTXLUHGE\WKLV$JUHHPHQWLQDVDWLVIDFWRU\DQG WLPHO\PDQQHU    F  WKHVDWLVIDFWLRQRIVXFKRWKHUFRQGLWLRQVDVDUH GHWHUPLQHGWREHDSSURSULDWHE\  HLWKHUSDUW\DQG    G  WKH 'HYHORSPHQW LV JHQHUDOO\ FRQVLVWHQW ZLWK WKH SURSRVDO VXEPLWWHG WR WKH $XWKRULW\¶V%RDUGRI&RPPLVVLRQHUVRQ2FWREHU  7KH &RQWUDFWV WRJHWKHU ZLWK DQ\ RWKHU DJUHHPHQWV HQWHUHG LQWREHWZHHQ WKH SDUWLHV KHUHWR FRQWHPSRUDQHRXVO\WKHUHZLWK ZKHQH[HFXWHGZLOOVXSHUVHGHDOOXQGHUVWDQGLQJVDQGREOLJDWLRQV RIWKHSDUWLHVKHUHXQGHU   6HFWLRQ'HYHORSPHQW'HVLJQ7KH'HYHORSHU¶VFRQFHSWIRUWKH'HYHORSPHQWRQWKH 'HYHORSPHQW3URSHUW\LVSUHOLPLQDU\LQQDWXUHDQGPXVWEHUHILQHGEHIRUHLPSOHPHQWDWLRQ7KH FRQFHSWDVSURSRVHGLQYROYHVWKHFUHDWLRQRIDILQDOSODWFRQVWUXFWLRQRIVLQJOHIDPLO\KRPHV ZLWKUHODWHGSXEOLFLQIUDVWUXFWXUHLPSURYHPHQWVLQFOXGLQJXWLOLWLHVQHZURDGVDQGVWRUPZDWHU SRQGLQJLPSURYHPHQWV   6HFWLRQ 'HYHORSHU8QGHUWDNLQJV'XULQJWKHWHUPRIWKLV$JUHHPHQWWKH'HYHORSHU VKDOOGRWKHIROORZLQJ   D  &RQWLQXHWRUHILQHLWVVLWHDQGEXLOGLQJSODQVIRUWKH'HYHORSPHQW   E  8QGHUWDNHSUHOLPLQDU\HQJLQHHULQJVRLOWHVWLQJERULQJVDQGJHRWHFKQLFDODQDO\VLV RIWKH'HYHORSPHQW3URSHUW\)RUWKLVSXUSRVHWKH'HYHORSHUDQGLWVFRQWUDFWRUV  Y7-*%5 VKDOOKDYHWKHULJKWWRHQWHUXSRQWKH$XWKRULW\3URSHUW\DWUHDVRQDEOHWLPHVDQG DIWHUQRWLFHWRWKH$XWKRULW\7KH'HYHORSHUVKDOOLQGHPQLI\GHIHQGDQGKROGWKH $XWKRULW\KDUPOHVVIURPDQGDJDLQVWDQ\FODLPVRUGDPDJHRIZKDWVRHYHUQDWXUH DULVLQJRXWRIWKHHQWU\RQWRWKH$XWKRULW\3URSHUW\DQGVKDOOUHSDLUDQ\GDPDJH FDXVHGWRWKH$XWKRULW\3URSHUW\7KLVREOLJDWLRQVKDOOVXUYLYHWHUPLQDWLRQRIWKH $JUHHPHQW    F  6XEPLW WR WKH $XWKRULW\ D SURSRVHG VFKHGXOH IRU WKH XQGHUWDNLQJ RI WKH 'HYHORSPHQWLQFOXGLQJWLPLQJRIWKHFORVLQJDQGFRPPHQFHPHQWDQGFRPSOHWLRQ RIFRQVWUXFWLRQDFWLYLWLHV   G  8VLQJWLWOHLQIRUPDWLRQDQGDVXUYH\SURYLGHGE\WKH$XWKRULW\XSGDWHHYLGHQFHRI WLWOHWRWKH$XWKRULW\3URSHUW\DQGSURYLGHWRWKH$XWKRULW\DQ\REMHFWLRQVWRWLWOH   H  6HHNWRVHFXUHDFRPPLWPHQWIRUILQDQFLQJVXIILFLHQWIRUFRQVWUXFWLRQRIWKHSXEOLF LQIUDVWUXFWXUHLPSURYHPHQWV   I  2EWDLQHQYLURQPHQWDOUHSRUWVDQGVWXGLHVSURYLGHGE\WKH$XWKRULW\DQGVXFKRWKHU VWXGLHV DQG WHVWLQJ GHHPHG QHFHVVDU\ WR GHWHUPLQH WKH DFFHSWDELOLW\ RI WKH HQYLURQPHQWDOFRQGLWLRQRIWKH$XWKRULW\3URSHUW\DQGDQ\$GGLWLRQDO3URSHUW\   J  ,GHQWLI\ WKH $GGLWLRQDO 3URSHUW\ WR EH DFTXLUHG WR XQGHUWDNH DQG FRPSOHWH WKH 'HYHORSPHQWDQGZRUNWRVHFXUHRSWLRQVRUSXUFKDVHDJUHHPHQWVZLWKWKHRZQHUV RIVXFKSURSHUW\   K  3UHSDUHVXEPLWDSSOLFDWLRQDQGUHFHLYHDOOQHFHVVDU\&LW\DSSURYDOVUHODWHGWRWKH VXEGLYLVLRQDQGGHYHORSPHQWRIWKH'HYHORSPHQW3URSHUW\   L  0DNHDOOUHTXLUHGSUHVHQWDWLRQVWRWKH&LW\&RXQFLORIWKH&LW\WKH$XWKRULW\¶V %RDUGRI&RPPLVVLRQHUVDQGWKH&LW\3ODQQLQJ&RPPLVVLRQLQFRQQHFWLRQZLWK VHHNLQJDSSURYDOVIRUWKH'HYHORSPHQW   $OORIWKHLQIRUPDWLRQGHVFULEHGDERYHVKDOOEHSUHSDUHGRUFROOHFWHGDWWKHVROHH[SHQVHRI WKH'HYHORSHU7KH'HYHORSHUVKDOOKDYHQRREOLJDWLRQWRSURYLGHWKH$XWKRULW\RU&LW\DQ\ UHSRUWVWHVWVDQDO\VHVRUDQ\RWKHUGXHGLOLJHQFHLWKDVSUHSDUHGLQWHUQDOO\RUREWDLQHGIURPDQ\ WKLUGSDUW\H[FHSWDVVSHFLILFDOO\SURYLGHGKHUHLQ   6HFWLRQ$XWKRULW\8QGHUWDNLQJV'XULQJWKHWHUPRIWKLV$JUHHPHQWWKH$XWKRULW\ZLOO XQGHUWDNHWKHIROORZLQJ  D &RRUGLQDWH DQ\ QHFHVVDU\ PHHWLQJV ZLWK WKH $XWKRULW\ &LW\ &RXQFLO 3ODQQLQJ &RPPLVVLRQDQGWKHFRPPXQLW\  E $VVLVW LQ LGHQWLI\LQJ SXEOLF LPSURYHPHQWV QHFHVVDU\ WR EH FRQVWUXFWHG LQ FRQQHFWLRQ ZLWK WKH 'HYHORSPHQW LQFOXGLQJ EXW QRW OLPLWHG WRXWLOLWLHV QHZ URDGZD\VDQGVWRUPZDWHUSRQGLQJ  Y7-*%5  F ,GHQWLI\FRQVWUXFWLRQSHUPLWDSSOLFDWLRQXWLOLW\DQGDQ\RWKHUIHHVDQGWKHDPRXQW RIVXFKIHHVWKDWWKH'HYHORSHUPD\EHH[SHFWHGWRSD\LQFRQQHFWLRQZLWKWKH 'HYHORSPHQW  G ,GHQWLI\WKHDSSURYDOSURFHVVDQGWLPHIUDPHVIRUGHYHORSPHQWDSSURYDOVWKDWPD\ EHH[SHFWHGIRUWKH'HYHORSPHQW  H 3URYLGH WR WKH 'HYHORSHU DQ\ WLWOH LQIRUPDWLRQ DQG DQ\ WKLUG SDUW\ UHSRUWV WKH $XWKRULW\KDVRQKDQGUHJDUGLQJWKH$XWKRULW\3URSHUW\  I 3URYLGH WR WKH 'HYHORSHU DQ\ VXUYH\V DQG HQYLURQPHQWDO UHSRUWVUHODWHG WR WKH $XWKRULW\3URSHUW\WKDWDUHLQWKHSRVVHVVLRQRIWKH$XWKRULW\7KH$XWKRULW\ZLOO DWWKH'HYHORSHU¶VH[SHQVHFRRSHUDWHZLWKWKH'HYHORSHULQSXUVXLQJDQ\IHGHUDO RU6WDWHHQYLURQPHQWDODSSURYDOVSHUPLWVSURJUDPHQUROOPHQWVRUGHWHUPLQDWLRQV UHTXHVWHGE\WKH'HYHORSHUZLWKUHVSHFWWRWKH$XWKRULW\3URSHUW\  J 1RWZLWKVWDQGLQJDQ\SURYLVLRQVRUXQGHUVWDQGLQJWRWKHFRQWUDU\QHLWKHUWKH&LW\ QRUWKH$XWKRULW\ZLOOH[HUFLVHLWVFRQGHPQDWLRQSRZHUVWRDFTXLUHDQ\DGGLWLRQDO SURSHUW\RURWKHUUHDOSURSHUW\LQFRQQHFWLRQZLWKWKH'HYHORSPHQW   6HFWLRQ&RQWLQJHQFLHV7KHSDUWLHVDFNQRZOHGJHDQGDJUHHWKDWSURFHHGLQJZLWKWKH 'HYHORSPHQWLVVXEMHFWWRDQXPEHURIFRQWLQJHQFLHVLQFOXGLQJEXWQRWOLPLWHGWRWKHIROORZLQJ   D  7KHDFTXLVLWLRQRIDOORUSDUWRIWKH'HYHORSPHQW3URSHUW\E\GLUHFWSXUFKDVHRQ VXFKWHUPVDQGFRQGLWLRQVDVDUHDFFHSWDEOHWRERWKSDUWLHV   E  7KH DFFHSWDQFH E\ WKH 'HYHORSHU RI LWV HQYLURQPHQWDODQG JHRWHFKQLFDO DVVHVVPHQWVDQGDOORWKHUHQYLURQPHQWDODQGZHWODQGUHSRUWVDQGVXUYH\VFHUWLILHG WR WKH 'HYHORSHU DQG LWV OHQGHU GHHPHG QHFHVVDU\ E\ WKH $XWKRULW\ DQG WKH 'HYHORSHUIRUDOORIWKHSURSHUW\WREHHQFRPSDVVHGE\WKH'HYHORSPHQWZKLFK UHSRUWVDQGVXUYH\VPXVWEHVDWLVIDFWRU\WRWKH$XWKRULW\DQGWKH'HYHORSHU   F 7KH$XWKRULW\DQGWKH'HYHORSHUKDYLQJREWDLQHGDOOQHFHVVDU\DSSURYDOVIRUWKH 'HYHORSPHQW IURP DOO DSSURSULDWH JRYHUQPHQWDO DXWKRULWLHV LQFOXGLQJ EXW QRW OLPLWHGWRDQ\QHFHVVDU\ZDWHUVKHGGLVWULFWDSSURYDOV   G 7KH 'HYHORSHU KDYLQJ REWDLQHG VXFK ODQG XVH DSSURYDOV IURP WKH &LW\ DV LV QHFHVVDU\WRDOORZWKH'HYHORSPHQWWRPRYHIRUZDUG   H  7LWOH WR WKH $XWKRULW\3URSHUW\ DQG DQ\ $GGLWLRQDO 3URSHUW\ KDYLQJ EHHQ IRXQG DFFHSWDEOHWRWKH'HYHORSHULQLWVVROHGLVFUHWLRQ   I  7KH'HYHORSHUKDYLQJFRQGXFWHGVXFKVRLOVZHOOHQJLQHHULQJKD]DUGRXVZDVWH HQYLURQPHQWDODQGRWKHUWHVWLQJDVLWGHWHUPLQHVQHFHVVDU\   Y7-*%5  J  7KH 'HYHORSHU KDYLQJ REWDLQHG ILQDQFLQJ IRU DW D PLQLPXP WKH SXEOLF LQIUDVWUXFWXUH LPSURYHPHQWV DFFHSWDEOH WR 'HYHORSHU DQG VDWLVIDFWRU\ WR WKH $XWKRULW\   6HFWLRQ1HJRWLDWLRQRI&RQWUDFWV'XULQJWKHWHUPRIWKLV$JUHHPHQWWKH$XWKRULW\DQG WKH'HYHORSHUVKDOOSURFHHGZLWKWKHQHJRWLDWLRQRI&RQWUDFWVUHODWLYHWRWKH'HYHORSPHQW7KH GHFLVLRQWRHQWHULQWRWKH&RQWUDFWVVKDOOEHLQWKHVROHGLVFUHWLRQRIHDFKRIWKHSDUWLHV,ISULRUWR H[HFXWLRQRIWKH&RQWUDFWVHLWKHUSDUW\GHWHUPLQHVLQLWVVROHGLVFUHWLRQWKDWLWLVQRWLQLWVEHVW LQWHUHVWIRUZKDWHYHUUHDVRQWRSURFHHGZLWKWKH'HYHORSPHQWRUWKH&RQWUDFWVLWVKDOOVRQRWLI\ WKHRWKHUSDUW\ZKHUHXSRQWKLV$JUHHPHQWVKDOOWHUPLQDWHDQGQHLWKHUSDUW\VKDOOKDYHDQ\ULJKWV RUREOLJDWLRQVWRWKHRWKHURUWRDQ\WKLUGSDUW\XQGHURUZLWKUHVSHFWWRWKLV$JUHHPHQWH[FHSWDV SURYLGHG LQ 6HFWLRQ  UHJDUGLQJ $XWKRULW\ FRVWV LQFXUUHG SULRUWR VXFK WHUPLQDWLRQ  ,I WKH 'HYHORSHUGHWHUPLQHVGXULQJWKHWHUPRIWKLV$JUHHPHQWWKDWXQGHUWDNLQJWKH'HYHORSPHQWLVQRW ILQDQFLDOO\IHDVLEOHLWZLOOSURPSWO\QRWLI\WKH$XWKRULW\RIVXFKGHWHUPLQDWLRQDQGWKHSDUWLHV ZLOOWHUPLQDWHWKLV$JUHHPHQW   6HFWLRQ(IIHFWRI$SSURYDOV1RDSSURYDOJLYHQE\WKH$XWKRULW\ KHUHXQGHURULQ FRQQHFWLRQ KHUHZLWK VKDOO EH GHHPHG WR FRQVWLWXWH DQ DSSURYDO RI WKH 'HYHORSPHQW IRU DQ\ SXUSRVHRWKHUWKDQDVVWDWHGKHUHLQDQGWKHSURFHVVRXWOLQHGLQWKLV$JUHHPHQWVKDOOQRWEH GHHPHGWRVXSHUVHGHDQ\FRQFHSWUHYLHZFRQGLWLRQDOXVHSHUPLWYDFDWLRQVXEGLYLVLRQRURWKHU ]RQLQJRUSODQQLQJDSSURYDOSURFHVVRIWKH$XWKRULW\RUWKH&LW\UHODWLYHWRWKHGHYHORSPHQWRI UHDOHVWDWH   6HFWLRQ   3D\PHQW RI &RVWV %RWK 3DUWLHV DUH DZDUH RI DQG DFNQRZOHGJH WKDW FRQWLQJHQFLHV DQG XQNQRZQV SUHVHQWO\ H[LVW DQ\ RQH RU PRUH RIZKLFK FRXOG PDNH WKH 'HYHORSPHQWFRVWSURKLELWLYHDQGWKDWERWKSDUWLHVDUHH[SHQGLQJVXPVRIPRQH\DQGWLPHZLWK IXOONQRZOHGJHRIWKHULVNVLQYROYHGDQGWKDWQHLWKHUSDUW\VKDOOEHOLDEOHIRUDQ\RIWKHRWKHU SDUW\¶VH[SHQVHVLQDQ\HYHQWH[FHSW L DVRWKHUZLVHSURYLGHGSXUVXDQWWRDVHSDUDWHDJUHHPHQW EHWZHHQWKHSDUWLHV LL LQFRQQHFWLRQZLWKDQDSSOLFDWLRQIRUD3XEOLF6XEVLG\RU LLL SXUVXDQW WRUHTXLUHGIHHVRUFRVWVUHODWHGWRDSSOLFDWLRQVPDGHWRWKH&LW\RUXQGHU&LW\&RGH   6HFWLRQ0RGLILFDWLRQV7KLV$JUHHPHQWPD\EHPRGLILHGDQGWKHWHUPKHUHRIPD\EH H[WHQGHG RQO\ WKURXJK ZULWWHQ DPHQGPHQWV KHUHWR VLJQHG E\ ERWKRI WKH SDUWLHV WR WKLV $JUHHPHQW   6HFWLRQ([FOXVLYH5LJKWV,QFRQVLGHUDWLRQRIWKHWLPHHIIRUWDQGH[SHQVHVWREH LQFXUUHGE\'HYHORSHULQSXUVXLQJWKHXQGHUWDNLQJVVHWIRUWKKHUHLQDQGLQIXUWKHUFRQVLGHUDWLRQ RIWKHIXQGVSDLGWRWKH$XWKRULW\WKHUHFHLSWRIZKLFKLVKHUHE\DFNQRZOHGJHGWKH$XWKRULW\ KHUHE\DJUHHVWKDWIRUWKHWHUPRIWKLV$JUHHPHQWLWZLOOQRWSURYLGHRUHQWHULQWRDQDJUHHPHQW ZLWK DQ\ WKLUG SDUW\ LQ FRQQHFWLRQ ZLWK DQ\ SURSRVHG GHYHORSPHQW RI WKH $XWKRULW\ 3URSHUW\'XULQJVXFKSHULRGWKH'HYHORSHUVKDOOKDYHWKHH[FOXVLYHULJKWWRZRUNZLWKWKH $XWKRULW\ LQ HVWDEOLVKLQJ GHILQLWLYH &RQWUDFWV IRU WKH 'HYHORSPHQW 3URSHUW\ 6DLG H[FOXVLYH ULJKWVVKDOOFRQWLQXHXQOHVVHDUOLHUWHUPLQDWHGDVSURYLGHGKHUHLQIRUWKHSHULRGGHVFULEHGZLWKLQ 6HFWLRQRIWKLV$JUHHPHQW   Y7-*%5  6HFWLRQ7HUPDQG7HUPLQDWLRQ7KLV$JUHHPHQWVKDOOEHHIIHFWLYHDVRIWKHGDWHILUVW ZULWWHQDERYHDQGVKDOOFRQWLQXHXQWLO$SULOXQOHVVWHUPLQDWHGHDUOLHULQDFFRUGDQFHZLWK 6HFWLRQ,IIRUDQ\UHDVRQWKH&RQWUDFWVKDYHQRWEHHQHQWHUHGLQWRE\WKHSDUWLHVE\VXFKGDWH RUDQ\PXWXDOO\DSSURYHGH[WHQVLRQWKHUHRIWKLV$JUHHPHQWVKDOOEHQXOODQGYRLGDQGQHLWKHU SDUW\ VKDOO KDYH DQ\ OLDELOLW\ RU REOLJDWLRQV WR WKH RWKHU H[FHSW DV SURYLGHG LQ 6HFWLRQ  UHJDUGLQJ$XWKRULW\FRVWVLQFXUUHGSULRUWRWKHWHUPLQDWLRQRIWKLV$JUHHPHQW   6HFWLRQ6HYHUDELOLW\,IDQ\SRUWLRQRIWKLV$JUHHPHQWLVKHOGLQYDOLGE\DFRXUWRI FRPSHWHQWMXULVGLFWLRQVXFKGHFLVLRQVKDOOQRWDIIHFWWKHYDOLGLW\RIDQ\UHPDLQLQJSRUWLRQRIWKLV $JUHHPHQW   6HFWLRQ1RWLFHV1RWLFHGHPDQGRURWKHUFRPPXQLFDWLRQIURPRQHSDUW\WRWKHRWKHU VKDOOEHGHHPHGHIIHFWLYHLIVHQWE\FHUWLILHGPDLOSRVWDJHSUHSDLGUHWXUQUHFHLSWUHTXHVWHGRU GHOLYHUHGSHUVRQDOO\WRDSDUW\DWLWVDGGUHVVLQWKHILUVWSDUDJUDSKRIWKLV$JUHHPHQWRUDWVXFK RWKHUDGGUHVVDVVXFKSDUW\PD\GHVLJQDWHLQZULWLQJWRWKHRWKHUSDUW\  ,1:,71(66:+(5(2)WKH$XWKRULW\KDVFDXVHGWKLV$JUHHPHQWWREHGXO\H[HFXWHG LQLWVQDPHDQGEHKDOIDQGWKH'HYHORSHUKDVFDXVHGWKLV$JUHHPHQWWREHGXO\H[HFXWHGLQLWV QDPHDQGEHKDOIRQRUDVRIWKHGDWHILUVWDERYHZULWWHQ   (&2120,& '(9(/230(17 $87+25,7< 2)%522./<1&(17(50,11(627$     %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB ,WV3UHVLGHQW   %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB ,WV([HFXWLYH'LUHFWRU    &HQWUD+RPHV//&   %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB  ,WVBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB Y7-*%5 (;+,%,7$ /HJDO'HVFULSWLRQRIWKH$XWKRULW\3URSHUW\                                          !  "           !                            #  $ % &  '"(    )    * +,#!    -./   #  ,   , &!  /  % 0 #                     !"  #$%&'  '$&(')* +,(-.' //$(- '0&&$' 1!#2 $'  $ # (-0! ('$'0 '' '! $2$'0 ''  '/#*'